Recombinant Podospora anserina Signal peptidase complex catalytic subunit SEC11 (SEC11)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Podospora anserina Signal Peptidase Complex Catalytic Subunit SEC11 (SEC11)

Recombinant Podospora anserina Signal Peptidase Complex Catalytic Subunit SEC11 (SEC11) is a protein expressed in E. coli and tagged with N-terminal His for purification and identification purposes . SEC11 is a catalytic subunit of the signal peptidase complex, which is an enzyme responsible for cleaving signal peptides from precursor proteins during protein translocation across the endoplasmic reticulum membrane . Podospora anserina is a filamentous fungus, used as a model organism in genetics and aging studies .

Gene Information

  • Gene Name: SEC11 .

  • Synonyms: SEC11; Pa_6_7190; PODANS_6_7190; Signal peptidase complex catalytic subunit SEC11; Signal peptidase I .

  • UniProt ID: B2B3T2 .

Functional Annotation and Significance

SEC11 is a crucial component of the signal peptidase complex, responsible for cleaving signal peptides from newly synthesized proteins that are destined for secretion or integration into cellular membranes . The signal peptidase complex is essential for protein processing and trafficking in eukaryotic cells.

Applications in Research

Recombinant SEC11 can be utilized in various research applications:

  • ** изучения энзиматических механизмов:** Studying the enzymatic mechanisms of signal peptide cleavage .

  • ** белок-белковые взаимодействия:** Investigating protein-protein interactions within the signal peptidase complex .

  • ** структурные исследования:** Conducting structural studies to understand the protein's architecture and function .

  • ** разработка ингибиторов:** Developing inhibitors that target SEC11 for potential therapeutic applications .

Podospora anserina as a Model Organism

Podospora anserina is a filamentous fungus used as a model organism to study genetics, particularly allorecognition and heterokaryon incompatibility, which involves regulated cell death when strains of unlike genotype fuse . It exhibits phenotypic senescence on solid medium but has an unlimited lifespan in submerged cultivation, making it valuable for studying adaptation and aging . P. anserina also produces hemicellulases that can enhance the saccharification of lignocellulosic biomass, showing its potential in industrial applications .

Data Table

CategoryDescription
NameRecombinant Full Length Podospora anserina Signal Peptidase Complex Catalytic Subunit SEC11(SEC11) Protein, His-Tagged
SourceE. coli
TagN-terminal His tag
Amino Acid Length1-177 aa
PurityGreater than 90% as determined by SDS-PAGE
Gene NameSEC11
UniProt IDB2B3T2
StorageStore at -20°C/-80°C, avoid repeated freeze-thaw cycles
BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If a specific tag is required, please inform us for preferential development.
Synonyms
SEC11; Pa_6_7190; PODANS_6_7190; Signal peptidase complex catalytic subunit SEC11; Signal peptidase I
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-177
Protein Length
full length protein
Species
Podospora anserina (strain S / ATCC MYA-4624 / DSM 980 / FGSC 10383) (Pleurage anserina)
Target Names
SEC11
Target Protein Sequence
MLSALGNPRQAAAQLMNFGLILSTAFMMWKGLSVISDSPSPIVVVLSGSMEPAFQRGDLL LLWNRNLFTETSVGEVVVYNVRDKDIPIVHRVISKFGTGFVIPRQWWLFMGIYNNDSDDT KLYAPGQNYLVREDIIGRSVVGYMPFVGYVTIMLSEHPWMKTVMLGIMGLVVVLQRE
Uniprot No.

Target Background

Function

The Recombinant Podospora anserina Signal Peptidase Complex Catalytic Subunit SEC11 (SEC11) is a catalytic component of the signal peptidase complex (SPC). It catalyzes the cleavage of N-terminal signal sequences from proteins destined for the endoplasmic reticulum (ER). This signal peptide cleavage occurs during, or after, translocation through the translocon pore into the ER.

Database Links
Protein Families
Peptidase S26B family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.