Recombinant Poinsettia latent virus Genome-linked protein precursor (ORF2)

Shipped with Ice Packs
In Stock

Description

Overview

Poinsettia latent virus (PnLV) is a virus regularly found in cultivated poinsettia plants worldwide, typically without causing noticeable symptoms . It spreads through grafting and vegetative propagation of the host plant, though its natural transmission method remains unknown . PnLV often occurs alongside poinsettia mosaic virus, but the two are genetically and serologically distinct . PnLV is classified within the genus Polemovirus, notable as a monotypic genus with genetic characteristics of both poleroviruses and sobemoviruses .

Genomic Organization

The PnLV genome comprises a single-stranded positive-sense RNA molecule of approximately 4.6 kb . Four open reading frames (ORFs) have been identified . The first three ORFs (ORF0, ORF1, and ORF2) show similarities to those found in members of the genus Polerovirus .

  • ORF0: Likely functions as a suppressor of gene silencing .

  • ORF1: Contains domains for helicase, a putative genome-linked protein (VPg), and protease .

  • ORF2: Encodes an RNA-dependent RNA polymerase (RdRp) . It is likely that ORF2 is translated via a frameshift from ORF1, sharing the same amino terminus .

  • ORF3: Encodes the viral coat protein and is believed to be translated from a subgenomic RNA (sgRNA) .

A subgenomic RNA (sgRNA) molecule of 1.07 kb, co-terminal with the 3' end of the genomic RNA, can be detected in infected cells, and a larger sgRNA of 2.60 kb may also be present . The 3' terminus is non-polyadenylated and is predicted to form a stable hairpin . It is likely that a VPg protein is covalently linked to the 5' end of the genomic RNA .

Recombinant Nature

PnLV is considered a chimeric virus because its genome shares similarities with both poleroviruses and sobemoviruses . The virus shows a close relationship to poleroviruses within the first three-quarters of its genome but to sobemoviruses in the last quarter . This arrangement suggests that PnLV may have arisen through recombination events between viruses from these two groups . RNA recombination is a key mechanism in the evolution of luteo-, sobemo-, and tombusviruses .

ORF2: RNA-Dependent RNA Polymerase

ORF2 encodes for RNA-dependent RNA polymerase (RdRp), an essential enzyme for viral replication . RdRp is responsible for synthesizing RNA from an RNA template, a process crucial for replicating the viral genome within the host cell . In poleroviruses, ORF2 is translated by frameshift from ORF1, thus sharing the same amino terminus .

Genome-Linked Protein (VPg)

Although not yet detected in vivo, the PnLV genome is predicted to encode a genome-linked protein (VPg) based on sequence data and comparison with poleroviruses . VPg is a small protein covalently linked to the 5' end of the viral RNA, playing a role in viral replication and translation . ORF1 contains a putative VPg domain .

Virus-Host Interaction

PnLV's presence in poinsettia plants typically does not result in obvious disease symptoms . The virus is transmitted through vegetative propagation, which means that it can be passed on when cuttings from infected plants are used to grow new plants . The natural means of transmission is still unknown .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to settle the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ORF2; Genome-linked protein precursor
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
417-660
Protein Length
Full Length of Mature Protein
Species
Poinsettia latent virus (isolate Euphorbia pulcherrima/Germany/Siepen/2005) (PnLV) (Poinsettia cryptic virus)
Target Names
ORF2
Target Protein Sequence
TTNVRGNLYNDEGFRLSVGEDDKAEHWTDRLMKSITFKTKRWADWAEEESESDDERGKVV PPAKPSNYGEGCPPEHNQYLSDVGDLLTKVIGPEQNEKCVDILMGIMGVDKNEVAPHKEE KAEKGNEAVVSATVKTVKEPTTQCDEDIISEIVKRVVDKMNLKAIEKSVVEILAEKAMTK APRGKRKNSKDTSRPSTPGSYIIPAKRTPDSGPVEKSLNSTGRAKEESPSGARTLPGNIP AWVR
Uniprot No.

Target Background

Function
A precursor protein likely releasing the VPg molecule at the initiation of RNA synthesis. Essential for viral replication.
Database Links

KEGG: vg:7040107

Protein Families
Peptidase S39B family
Subcellular Location
Host membrane; Multi-pass membrane protein.

Q&A

What is Poinsettia latent virus and how is it classified?

Poinsettia latent virus (PnLV), formerly known as Poinsettia cryptic virus, is a chimeric virus that infects Euphorbia pulcherrima (poinsettia) plants worldwide without inducing visible symptoms. The virus contains a single-stranded positive-sense RNA genome of 4,652 nucleotides. PnLV presents a unique taxonomic case as it shares genomic features with both poleroviruses and sobemoviruses, showing polerovirus-like sequences in approximately three-quarters of its genome and sobemovirus-like sequences in the remaining quarter. Based on this chimeric nature, researchers have proposed classifying it as a "polemovirus" .

The virus forms stable icosahedral particles measuring approximately 34 nm in diameter, consistent with its sobemovirus-related coat protein structure . Despite its widespread presence in commercial poinsettia cultivars, PnLV remains latent, causing no apparent disease symptoms in infected plants, which has significant implications for both research and agricultural practices.

How does the genome organization of PnLV differ from related viruses?

This genomic architecture differs from both parent-like virus groups in several key ways:

Genome FeaturePnLVTypical PolerovirusTypical Sobemovirus
Genome size4,652 bases5,500-6,000 bases4,000-4,500 bases
RNA structureSingle positive-strandSingle positive-strandSingle positive-strand
ORF arrangementChimeric organizationConserved polerovirus arrangementConserved sobemovirus arrangement
Replication mechanismPolerovirus-likeRNA-dependent RNA polymeraseRNA-dependent RNA polymerase
Coat protein homologySobemovirus-likePolerovirus conservedSobemovirus conserved
Particle morphology34 nm icosahedra25-30 nm icosahedra25-30 nm icosahedra

This unique genome organization makes PnLV a valuable model for studying viral recombination and evolution mechanisms.

What is the function of the genome-linked protein precursor in viral replication?

The genome-linked protein precursor (ORF2) plays several critical roles in PnLV replication:

  • Proteolytic processing: The serine protease domain cleaves viral polyproteins into functional units necessary for replication complex formation.

  • Genome linkage: The VPg portion becomes covalently attached to the 5' end of the viral RNA, serving as a primer for RNA synthesis and protecting the genome from host nucleases.

  • Host interaction: Specific regions interact with host factors to facilitate viral replication and potentially suppress host defense mechanisms.

  • Replication complex formation: The protein participates in the assembly of viral replication factories within infected cells.

This multifunctional nature makes the ORF2 protein central to understanding PnLV infection dynamics and developing potential control strategies. The protein's chimeric evolutionary origin also provides insights into how recombination events can generate functional viral proteins with expanded capabilities .

What methods are optimal for expression and purification of recombinant PnLV ORF2?

Researchers working with recombinant PnLV ORF2 should consider the following optimized expression and purification approach:

Expression system selection:

  • Bacterial systems (E. coli BL21) are suitable for basic structural studies but may lack post-translational modifications

  • Baculovirus-insect cell systems provide superior folding for enzymatic activity studies

  • Plant-based expression systems (N. benthamiana) offer the most authentic protein processing environment

Purification protocol:

  • Initial clarification through centrifugation (10,000 × g, 20 min, 4°C)

  • Affinity chromatography using His-tag or custom antibody matrices

  • Size exclusion chromatography to separate oligomeric states

  • Ion-exchange chromatography for final polishing

Critical parameters for retention of activity:

  • Storage buffer: Tris-based buffer with 50% glycerol at pH 7.5-8.0

  • Storage temperature: -20°C for short-term, -80°C for extended preservation

  • Avoiding repeated freeze-thaw cycles to maintain structural integrity

When designing expression constructs, researchers should consider using codon optimization for the expression host and incorporating a cleavable affinity tag that minimizes interference with protein function.

How can researchers verify the authenticity and activity of recombinant PnLV ORF2?

Verification of recombinant PnLV ORF2 authenticity and activity requires a multi-faceted approach:

Structural verification:

  • SDS-PAGE analysis to confirm molecular weight (expected ~27 kDa)

  • Western blot using anti-VPg and anti-serine protease domain antibodies

  • Mass spectrometry analysis to verify the amino acid sequence

  • Circular dichroism spectroscopy to assess secondary structure elements

Functional verification:

  • Proteolytic activity assay using synthetic peptide substrates containing the native cleavage sites

  • RNA binding assay to confirm VPg domain functionality

  • In vitro translation inhibition assay to assess biological activity

  • Subcellular localization studies in plant protoplasts using fluorescently tagged constructs

Quality control parameters:

  • Purity >95% as determined by densitometry

  • Endotoxin levels <0.1 EU/μg for in vivo applications

  • Consistent specific activity across batches

  • Thermal stability assessment using differential scanning fluorimetry

These verification steps ensure that experimental results using the recombinant protein accurately reflect native viral protein characteristics.

How does the chimeric nature of PnLV influence genome-linked protein function?

The chimeric origin of PnLV presents unique research questions regarding the functionality of its genome-linked protein. The protein combines features from both polerovirus and sobemovirus ancestors, creating a novel functional entity with potentially expanded capabilities.

Research indicates that this chimeric nature likely arose through recombination events between ancestral viruses, creating a functional hybrid that retains key activities from both parents. Molecular evidence suggests that the 5' and extreme 3' regions of PnLV RNA, which are polerovirus-like, dictate the replication mechanism, while the sobemovirus-derived regions contribute to structural functions .

This hybrid structure may provide several evolutionary advantages:

  • Expanded host range potential through combined recognition patterns

  • Novel enzymatic activities not present in either parent virus

  • Enhanced ability to evade host defense mechanisms

  • Structural stability improvements from sobemovirus-derived regions

When studying recombinant ORF2, researchers should be aware that domain interactions may differ from those in non-chimeric viral proteins, potentially affecting experimental outcomes. The protein's evolutionary history makes it an excellent model for studying viral protein adaptation and functional conservation across taxonomic boundaries.

What experimental approaches can differentiate between latent and active forms of PnLV?

Distinguishing between latent and active forms of PnLV requires sophisticated experimental approaches that can detect subtle differences in viral activity states. Unlike many plant viruses that produce visible symptoms, PnLV remains asymptomatic in infected poinsettia plants, necessitating molecular and biochemical detection methods .

Recommended differential detection approaches:

  • Quantitative viral RNA analysis:

    • RT-qPCR targeting conserved genomic regions with standard curves

    • Northern blot analysis to detect genomic and subgenomic RNAs

    • Small RNA sequencing to identify virus-derived siRNAs indicating active silencing responses

  • Viral protein detection:

    • Western blot analysis comparing coat protein and genome-linked protein levels

    • Immunocapture-RT-PCR to assess encapsidated versus free viral RNA

    • In situ immunofluorescence to visualize viral replication complexes

  • Host response markers:

    • Transcriptome analysis to identify differentially expressed host genes

    • Metabolomic profiling to detect biochemical changes associated with active replication

    • Analysis of salicylic acid and jasmonic acid pathways activation

  • Replication assays:

    • Cell fractionation followed by strand-specific RT-PCR to detect negative-strand intermediates

    • Metabolic labeling of newly synthesized viral RNAs

    • Double-stranded RNA extraction and analysis

These approaches can provide a comprehensive picture of viral activity states and help researchers understand the molecular basis of PnLV latency.

What are the optimal conditions for studying PnLV ORF2 protein-protein interactions?

Investigating protein-protein interactions involving PnLV ORF2 requires carefully optimized experimental conditions to maintain native structure and function. Researchers should consider the following methodological approaches:

In vitro interaction studies:

  • Co-immunoprecipitation (Co-IP):

    • Buffer composition: 50 mM Tris-HCl pH 7.5, 150 mM NaCl, 0.5% NP-40, 1 mM EDTA, protease inhibitor cocktail

    • Antibody selection: Anti-tag antibodies for recombinant proteins or custom antibodies against conserved ORF2 epitopes

    • Controls: Tag-only proteins and irrelevant antibodies to assess non-specific binding

  • Pull-down assays with purified components:

    • Recombinant GST-tagged or His-tagged ORF2 as bait protein

    • Plant cell lysates or purified candidate interactors as prey

    • Washes of increasing stringency to eliminate non-specific interactions

In vivo interaction studies:

  • Bimolecular Fluorescence Complementation (BiFC):

    • Expression vectors: Split YFP/GFP fused to ORF2 and candidate interactors

    • Host system: Nicotiana benthamiana via Agrobacterium-mediated transient expression

    • Controls: Known interaction pairs and non-interacting protein combinations

  • Proximity-dependent biotin identification (BioID):

    • Fusion construct: ORF2-BirA* biotin ligase fusion

    • Expression in plant systems followed by streptavidin pull-down

    • Mass spectrometry identification of biotinylated proximal proteins

When interpreting results, researchers should be aware that the chimeric nature of PnLV ORF2 may create interaction interfaces not typically found in other viral proteins, potentially leading to novel host factor interactions.

How can researchers effectively compare PnLV ORF2 with related viral proteins?

Comparative analysis of PnLV ORF2 with related viral proteins provides valuable insights into functional conservation, evolutionary relationships, and potential therapeutic targets. Researchers should employ a systematic approach:

Sequence-based comparative methods:

  • Multiple sequence alignment:

    • Include ORF2 proteins from poleroviruses and VPg/protease regions from sobemoviruses

    • Use MUSCLE or MAFFT algorithms optimized for divergent sequences

    • Focus on conserved motifs in catalytic domains and RNA-binding regions

  • Phylogenetic analysis:

    • Maximum likelihood methods with appropriate substitution models

    • Bayesian inference for complex evolutionary relationships

    • Recombination detection algorithms to identify potential breakpoints

Structural comparative approaches:

  • Homology modeling:

    • Template selection from solved structures of related viral proteins

    • Model validation through Ramachandran plots and QMEAN scores

    • Identification of conserved surface patches and electrostatic potentials

  • Functional domain mapping:

    • Enzymatic assays comparing catalytic efficiency of protease domains

    • RNA binding assays comparing VPg domains from different viruses

    • Subcellular localization patterns across viral protein families

Comparative experimental strategies:

  • Parallel expression and purification using identical systems

  • Side-by-side functional assays under standardized conditions

  • Cross-complementation studies in viral infection models

  • Inhibitor sensitivity profiling across related viral proteins

This comprehensive comparative approach reveals both conserved features essential for viral function and unique aspects that may contribute to PnLV's distinctive biological properties.

How can PnLV ORF2 serve as a model for understanding viral evolution?

PnLV ORF2 represents an exceptional model for studying viral evolution, particularly in understanding the mechanisms and consequences of recombination between distinct viral lineages. The chimeric nature of PnLV, with its polerovirus-like and sobemovirus-like regions, provides a natural example of successful cross-family recombination .

Key research applications include:

  • Evolutionary fitness studies:

    • Comparing replication efficiency between PnLV and parent-like viruses

    • Assessing host range differences resulting from chimeric protein functions

    • Measuring selective pressures on different domains using dN/dS analysis

  • Recombination hotspot identification:

    • Fine mapping of recombination junctions in the PnLV genome

    • Structural analysis of RNA elements that might facilitate template switching

    • Experimental evolution studies to detect new recombination events

  • Functional innovation through recombination:

    • Characterizing novel activities not present in either parent virus

    • Identifying synergistic interactions between domains of different origins

    • Mapping how recombination affects protein-protein interaction networks

  • Phylogenetic classification challenges:

    • Development of new taxonomic approaches for recombinant viruses

    • Establishment of criteria for defining new viral genera like "polemoviruses"

    • Computational methods for detecting and classifying recombinant viruses

The study of PnLV ORF2 challenges traditional concepts of viral species boundaries and demonstrates how functional viral proteins can arise through genetic exchange between distant lineages, with implications for understanding emerging viral pathogens.

What are the potential applications of recombinant PnLV ORF2 in biotechnology?

The unique properties of recombinant PnLV ORF2 present several promising applications in biotechnology and research tools:

  • Vector development for plant biotechnology:

    • The non-symptomatic nature of PnLV makes its components ideal for expression vectors

    • ORF2-derived elements could facilitate RNA stability in transgenic plants

    • VPg domain adaptations for enhanced transgene expression

  • Enzyme technology applications:

    • The serine protease domain exhibits high specificity useful for protein engineering

    • Development of customized proteases for biotechnological applications

    • Structure-based design of proteases with novel substrate specificities

  • Research tool development:

    • ORF2-based affinity tags for protein purification systems

    • RNA-binding domains as research reagents for RNA isolation

    • Diagnostic reagents for detection of related viral pathogens

  • Vaccine and antiviral strategies:

    • Development of apple latent spherical virus (ALSV) vector vaccines incorporating PnLV elements

    • Design of broad-spectrum antivirals targeting conserved protease domains

    • Recombinant proteins as antigens for diagnostic antibody production

While these applications require further research and development, the chimeric nature of PnLV ORF2 makes it a particularly interesting candidate for biotechnological adaptation, potentially combining advantages from multiple viral systems into novel functional tools.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.