Recombinant Polaromonas naphthalenivorans Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Introduction to Polaromonas naphthalenivorans

Polaromonas naphthalenivorans is a Gram-negative, oxidase- and catalase-positive bacterium belonging to the class Betaproteobacteria within the phylum Pseudomonadota. This non-spore-forming, nonmotile microorganism was initially isolated from coal-tar contaminated freshwater sediment, highlighting its adaptation to polluted environments . The bacterium forms distinctive colonies characterized by a smooth and glistening surface, providing a visual identifier in laboratory cultures .

The taxonomic classification of P. naphthalenivorans places it within the family Comamonadaceae and order Burkholderiales. The type strain, designated as CJ2, has been deposited in several culture collections including ATCC BAA-779, CCUG 51246, and DSM 15660 . This classification is significant as it positions the organism among other environmentally relevant bacteria known for their biodegradative capabilities.

One of the most notable characteristics of P. naphthalenivorans is its ability to degrade naphthalene, a polycyclic aromatic hydrocarbon commonly found in environmental contaminants . This metabolic capability has positioned the bacterium as a potential bioremediation agent for environments polluted with these persistent organic compounds. Research has shown that P. naphthalenivorans metabolizes naphthalene via the gentisate pathway, rather than the more common catechol pathway observed in other naphthalene-degrading bacteria .

Overview of Disulfide Bond Formation Protein B (dsbB)

Disulfide Bond Formation Protein B (dsbB) represents a critical component in bacterial protein folding machinery. This protein belongs to a family of disulfide oxidoreductases responsible for catalyzing the formation of disulfide bonds in bacterial proteins, particularly those destined for the periplasmic space or outer membrane. The presence of correctly formed disulfide bonds is essential for maintaining protein structure and function in these cellular compartments.

In the bacterial disulfide bond formation pathway, dsbB typically functions as an integral membrane protein that reoxidizes another protein called dsbA. After dsbA catalyzes disulfide bond formation in substrate proteins, it becomes reduced and must be reoxidized by dsbB to continue its catalytic cycle. This electron transfer cascade ultimately connects to the respiratory chain, making disulfide bond formation an energy-dependent process linked to cellular respiration.

The importance of dsbB cannot be overstated in the context of bacterial physiology. Proteins containing disulfide bonds are often involved in critical cellular processes including nutrient acquisition, stress response, and virulence factor production. In P. naphthalenivorans specifically, the dsbB protein likely plays a crucial role in ensuring proper folding of proteins involved in naphthalene degradation and other metabolic pathways that enable survival in contaminated environments.

Applications and Research Implications

The recombinant P. naphthalenivorans dsbB protein has significant potential for various research and biotechnological applications. These applications span multiple fields including structural biology, protein biochemistry, environmental microbiology, and bioremediation technology.

In structural biology, the recombinant protein can serve as a model for understanding membrane-bound oxidoreductases and their mechanisms of action. The protein's role in disulfide bond formation makes it a valuable subject for studies on protein folding and stability in bacteria adapted to contaminated environments.

From a bioremediation perspective, understanding the function of dsbB in P. naphthalenivorans could contribute to optimizing naphthalene degradation processes. Given the bacterium's unique ability to degrade naphthalene while exhibiting sensitivity to higher concentrations, insights into the role of dsbB in protein folding could potentially lead to enhanced bioremediation strategies through genetic or metabolic engineering approaches.

The recombinant protein also serves as an important reagent for enzyme assays, antibody production, and protein-protein interaction studies. Such research tools can facilitate further investigation into the disulfide bond formation pathway in P. naphthalenivorans and its relationship to naphthalene metabolism.

Additionally, comparative analyses between dsbB proteins from P. naphthalenivorans and other bacterial species could provide evolutionary insights into how disulfide bond formation systems have adapted across different bacterial lineages, particularly those occupying specialized ecological niches such as contaminated environments.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs as much as possible.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
dsbB; Pnap_1547; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Polaromonas naphthalenivorans (strain CJ2)
Target Names
dsbB
Target Protein Sequence
MFLNLLDAPRRLLALVALGCVALLAFGLYLQHVVGLEPCPMCIVQRYALVLVAIVAGLTA ITSNKKGLITGSGVLLLLAGFGAFVAARQSFLQWYPPEVASCGRDFYGMIETFPLQRAIP MIFKGSGDCAKVDWTFLGGSIANWSFVCFAVIGLTALTLIARLARQR
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in some periplasmic proteins. It functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.