Recombinant Polaromonas naphthalenivorans NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is produced in E. coli and purified via affinity chromatography. Critical parameters include:

  • Stability: Lyophilized powder stored at -20°C/-80°C; avoid repeated freeze-thaw cycles .

  • Reconstitution: Recommended in deionized water (0.1–1.0 mg/mL) with 5–50% glycerol for long-term storage .

  • Applications: Used in enzymatic assays, structural studies, and antibody development for ELISA kits .

Role in Bacterial Respiration

nuoA interacts with other Complex I subunits (e.g., NuoB, NuoC) to form a functional proton-pumping module. Structural studies in E. coli revealed its cytoplasmic localization, critical for electron transfer efficiency .

Genomic Context

The nuoA gene resides on the chromosome of P. naphthalenivorans, part of a conserved operon encoding Complex I components. Horizontal gene transfer events are evident in the genome, but nuoA shows no significant horizontal transfer signals .

Experimental Tools and Resources

Commercially available recombinant nuoA enables:

  • Immunoassays: ELISA kits for detecting nuoA in bacterial lysates or environmental samples .

  • Structural Biology: Crystallization and cryo-EM studies to resolve membrane topology .

  • Enzymatic Reconstitution: Functional assays to probe Complex I activity in vitro .

Challenges and Future Directions

  • Membrane Integration: Solving the high-resolution structure of nuoA remains challenging due to its hydrophobic nature.

  • Functional Diversity: Comparative studies with homologs from other betaproteobacteria (e.g., Comamonadaceae) may reveal conserved or divergent mechanisms.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
nuoA; Pnap_1424; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Polaromonas naphthalenivorans (strain CJ2)
Target Names
nuoA
Target Protein Sequence
MNLDQYLPVLLFILVGVGVGILPMVLGRLLGPVRPDSEKNSPYECGFEAFEDARMKFDVR YYLVAILFILFDLEIAFLFPWAVSLKEIGALGFWSVMVFLGILVVGFVYEWKKGALDWE
Uniprot No.

Target Background

Function
NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the immediate electron acceptor. This redox reaction is coupled to proton translocation; four hydrogen ions are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving energy in a proton gradient.
Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Polaromonas naphthalenivorans NADH-quinone oxidoreductase subunit A (nuoA)?

Recombinant Polaromonas naphthalenivorans NADH-quinone oxidoreductase subunit A (nuoA) is a full-length protein (119 amino acids) that functions as a subunit of the NADH dehydrogenase I complex in Polaromonas naphthalenivorans. When produced recombinantly, it is typically expressed in E. coli with an N-terminal histidine tag to facilitate purification . The protein is part of the respiratory chain and plays a role in energy metabolism. The gene is also known as NUO1 in some classification systems and contributes to the organism's ability to metabolize various carbon sources, potentially including naphthalene and its derivatives .

How is Recombinant Polaromonas naphthalenivorans nuoA protein expressed and purified?

The expression and purification of Recombinant Polaromonas naphthalenivorans NADH-quinone oxidoreductase subunit A (nuoA) involves several methodological steps:

Expression System:

  • Host organism: Escherichia coli

  • Expression vector: Contains nuoA gene (1-119 amino acids) with an N-terminal histidine tag

  • Induction conditions: Typically using IPTG under the control of a strong promoter (e.g., T7)

Purification Protocol:

  • Cell lysis: Bacterial cells are disrupted to release the recombinant protein

  • Affinity chromatography: His-tagged protein is captured using nickel or cobalt resin

  • Washing: Non-specifically bound proteins are removed with washing buffers

  • Elution: Target protein is eluted with imidazole-containing buffer

  • Quality control: SDS-PAGE analysis to verify purity (>90%)

  • Lyophilization: Protein is freeze-dried for stability and storage

The final product is typically provided as a lyophilized powder in Tris/PBS-based buffer with 6% trehalose at pH 8.0, which helps maintain protein stability during storage and reconstitution .

What are the optimal storage and handling conditions for recombinant nuoA?

Proper storage and handling of Recombinant Polaromonas naphthalenivorans NADH-quinone oxidoreductase subunit A (nuoA) is critical for maintaining its structural integrity and functional activity:

Storage Recommendations:

  • Long-term storage: -20°C or -80°C

  • Working aliquots: 4°C for up to one week

  • Avoid repeated freeze-thaw cycles which can cause protein degradation

Reconstitution Protocol:

  • Centrifuge the vial briefly before opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • For long-term storage of reconstituted protein, add glycerol to 5-50% final concentration

  • Aliquot the solution to minimize freeze-thaw cycles

Buffer Composition:

  • Storage buffer: Tris/PBS-based buffer containing 6% trehalose at pH 8.0

  • The trehalose component helps protect protein structure during freeze-drying and reconstitution

Following these storage and handling guidelines ensures optimal protein stability and experimental reproducibility when working with recombinant nuoA.

What is the role of NADH-quinone oxidoreductase in bacterial metabolism?

NADH-quinone oxidoreductase (Complex I) plays several crucial roles in bacterial energy metabolism:

Primary Functions:

  • Electron transport: Transfers electrons from NADH to quinones in the respiratory chain

  • Proton translocation: Couples electron transfer to proton pumping across the membrane

  • Energy conservation: Contributes to ATP synthesis by generating proton motive force

  • Redox homeostasis: Maintains NAD+/NADH balance in the cell

Metabolic Context in Polaromonas naphthalenivorans:

  • P. naphthalenivorans CJ2 can use naphthalene as a sole carbon source

  • During naphthalene catabolism, NADH is generated through various oxidation steps

  • NADH-quinone oxidoreductase (including nuoA) oxidizes this NADH to NAD+

  • This regeneration of NAD+ is essential for continued operation of catabolic pathways

  • The enzyme thus links naphthalene degradation to energy conservation through respiratory electron transport

The nuoA subunit, as part of the membrane domain of Complex I, likely contributes to the proton-pumping function of the enzyme, helping to generate the proton gradient that drives ATP synthesis.

How does nuoA relate to the naphthalene degradation pathway in Polaromonas naphthalenivorans?

Metabolic Integration:

  • P. naphthalenivorans CJ2 was isolated from a coal tar waste-contaminated site and can grow using naphthalene as its sole carbon source

  • The naphthalene catabolic (nag) genes in P. naphthalenivorans are organized in two distinct clusters:

    • Large cluster: nagRAaGHAbAcAdBFCQEDJI′ORF1tnpA

    • Small cluster: nagR2ORF2I"KL

  • These genes encode enzymes that convert naphthalene to central metabolites via the gentisate pathway

Energetic Coupling:

  • Naphthalene degradation generates reducing equivalents (NADH)

  • NADH-quinone oxidoreductase (containing nuoA) couples NADH oxidation to energy conservation

  • This coupling is essential for efficient growth on naphthalene as a sole carbon source

  • Mutations in respiratory chain components could potentially affect growth rates on naphthalene

The relationship between naphthalene degradation and respiratory functions highlights the integrated nature of bacterial metabolism, where catabolic pathways are tightly coupled to energy conservation mechanisms.

What experimental approaches can be used to study structure-function relationships of nuoA?

Several methodological approaches can be employed to investigate the structure-function relationship of Polaromonas naphthalenivorans NADH-quinone oxidoreductase subunit A (nuoA):

Structural Studies:

  • X-ray crystallography:

    • Express and purify large quantities of recombinant nuoA

    • Attempt crystallization using vapor diffusion or lipidic cubic phase methods

    • Solve the structure and analyze membrane-embedded regions

  • Cryo-electron microscopy:

    • Purify the entire NADH-quinone oxidoreductase complex

    • Analyze nuoA in the context of the complete enzyme

    • Map interactions with other subunits

Functional Analysis:

  • Site-directed mutagenesis:

    • Target conserved residues based on sequence alignments

    • Generate alanine-scanning mutants of transmembrane domains

    • Assess functional consequences using activity assays

  • Complementation studies:

    • Create nuoA knockout in P. naphthalenivorans using insertional inactivation

    • Complement with wild-type or mutant variants

    • Analyze growth phenotypes on naphthalene and other carbon sources

Protein-Protein Interaction Studies:

  • Crosslinking experiments:

    • Use membrane-permeable crosslinkers to capture interactions

    • Identify interaction partners by mass spectrometry

    • Map interaction interfaces

  • Bacterial two-hybrid systems:

    • Test specific interactions with other respiratory complex components

    • Identify residues critical for complex assembly

These integrated approaches can provide insights into how nuoA contributes to NADH-quinone oxidoreductase function and energy metabolism in P. naphthalenivorans.

How can insertional inactivation methods be applied to study nuoA function?

Based on successful approaches used for regulatory genes in P. naphthalenivorans, the following methodology can be applied to study nuoA function through insertional inactivation:

Campbell-type Homologous Recombination Protocol:

  • Suicide Vector Construction:

    • Select a suicide vector such as pVIK110 containing:

      • R6K oriV region (requires λ pir replication system)

      • Kanamycin resistance marker

      • Multiple cloning sites

  • Target Fragment Preparation:

    • Design primers to amplify an internal fragment of nuoA (300-400 bp)

    • Add restriction sites (e.g., XbaI/SalI) to primer ends

    • PCR amplify the fragment and verify by sequencing

  • Cloning and Conjugation:

    • Clone the fragment into the suicide vector

    • Transform into E. coli S17-1 λ pir for conjugation

    • Perform bacterial mating with rifampin-resistant P. naphthalenivorans CJ2

    • Incubate conjugation mixture on R2A agar at 25°C for 16 hours

  • Selection and Verification:

    • Select transconjugants on media containing kanamycin (40 μg/ml) and rifampin (200 μg/ml)

    • Verify gene disruption by PCR using primers that span the integration site

    • Confirm phenotypic effects on growth and respiratory activity

Expected Outcomes:

  • Growth defects on minimal media with various carbon sources

  • Altered growth kinetics on naphthalene (similar to effects seen with nagR mutants)

  • Changes in NADH oxidation rates

  • Potential effects on expression of other respiratory genes

This approach has been successfully used to create regulatory gene mutants in P. naphthalenivorans CJ2, such as strains CJN110 (nagR mutant) and CJM110 (nagR2 mutant) , and can be adapted for studying nuoA function.

What methodological approaches are recommended when data contradicts hypotheses about nuoA function?

When studying nuoA function in Polaromonas naphthalenivorans, researchers may encounter unexpected or contradictory data. A systematic approach to handling such scenarios includes:

1. Comprehensive Data Examination:

  • Thoroughly analyze the data to identify specific contradictions or unexpected patterns

  • Compare results with published literature on homologous proteins

  • Evaluate outliers and determine whether they represent significant findings or experimental artifacts

2. Experimental Design Reassessment:

  • Review experimental conditions, particularly those relevant to P. naphthalenivorans growth:

    • Temperature (P. naphthalenivorans is psychrotolerant)

    • Inoculum size (significant effects observed with <3% vs. 8% inoculum)

    • Growth phase (log vs. stationary)

    • Media composition

3. Alternative Hypothesis Generation:

  • Formulate new hypotheses that could explain the contradictory results

  • Consider dual functionality of nuoA in respiration and other metabolic processes

  • Evaluate potential regulatory cross-talk between respiratory and catabolic pathways

4. Methodological Expansion:

  • Implement complementary experimental approaches:

    • Transcriptomics to analyze gene expression patterns

    • Proteomics to assess protein-protein interactions

    • Metabolomics to measure changes in metabolic fluxes

    • In silico modeling of respiratory complex assembly

Contradictory ObservationPotential ExplanationMethodological Approach
Growth not affected by nuoA mutationMetabolic redundancyConstruct double/triple mutants of respiratory components
Unexpected expression patternsMultiple promoters5' RACE analysis, promoter-reporter fusions
Altered naphthalene degradationRedox imbalanceMeasure NAD+/NADH ratios in mutants
Phenotypic variabilityGrowth condition sensitivitySystematic variation of culture conditions

As demonstrated in studies of nagR and nagR2 mutants in P. naphthalenivorans, contradictory phenotypes can lead to important discoveries about regulatory networks .

How can regulatory elements controlling nuoA expression be identified and characterized?

Understanding the regulation of nuoA expression in Polaromonas naphthalenivorans requires a multi-faceted approach combining molecular genetics, biochemistry, and bioinformatics:

1. Promoter Analysis and Characterization:

  • In silico analysis:

    • Identify potential promoter elements upstream of nuoA

    • Search for conserved regulatory motifs in respiratory genes

    • Compare with known transcriptional start sites in related bacteria

  • Experimental mapping:

    • Use 5' RACE to identify transcription start sites

    • Construct promoter-reporter fusions (e.g., with lacZ)

    • Measure promoter activity under different growth conditions

2. Regulator Identification:

  • DNA-protein interaction studies:

    • Perform electrophoretic mobility shift assays (EMSA) with nuoA promoter fragments

    • Use DNA affinity chromatography to isolate binding proteins

    • Identify candidate regulators by mass spectrometry

  • Genetic approaches:

    • Create insertional mutations in candidate regulators (similar to nagR/nagR2 studies)

    • Assess effects on nuoA expression using qRT-PCR or reporter assays

    • Test for cross-regulation between respiratory and naphthalene degradation pathways

3. Environmental Response Analysis:

  • Expression profiling:

    • Monitor nuoA expression during growth on different carbon sources (including naphthalene)

    • Assess effects of oxygen limitation, redox stress, and temperature

    • Compare expression patterns with other respiratory and metabolic genes

  • Mutant analysis:

    • Compare expression in wild-type vs. regulatory mutants (e.g., nagR, nagR2)

    • Assess growth phenotypes under different conditions

    • Measure NADH dehydrogenase activity in relation to expression levels

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.