Recombinant Polaromonas naphthalenivorans Prolipoprotein diacylglyceryl transferase (lgt)

Shipped with Ice Packs
In Stock

Description

Amino Acid Sequence and Conserved Motifs

The full-length protein sequence begins with mLIHPEINPVALQLGPLAIHWYGLTY... and includes a highly conserved "Lgt signature motif" essential for enzymatic activity. Structural homology with Escherichia coli Lgt suggests:

  • Transmembrane Topology: Seven transmembrane segments, with the N-terminus facing the periplasm and the C-terminus in the cytoplasm.

  • Critical Residues: Tyrosine-26 (Y26), asparagine-146 (N146), and glycine-154 (G154) are indispensable for catalytic function .

Mechanism of Action

Lgt transfers the sn-1,2-diacylglyceryl moiety from phosphatidylglycerol to prolipoproteins, enabling membrane anchoring. This step is essential for bacterial viability, as demonstrated by growth arrest in E. coli Lgt-depletion strains .

Biological Context in P. naphthalenivorans

P. naphthalenivorans CJ2 is a naphthalene-degrading bacterium isolated from coal-tar-contaminated sediments . While its lgt gene has not been directly studied, genomic data and metabolic research suggest that lipoprotein processing by Lgt is vital for:

  • Membrane integrity in hydrocarbon-rich environments.

  • Survival under stress caused by toxic metabolites like naphthoquinones .

Antibiotic Development

Lgt is a potential target for novel antibiotics. Inhibitors of E. coli Lgt disrupt lipoprotein biogenesis, causing cell death . Similar strategies could apply to P. naphthalenivorans Lgt, particularly for combating environmental pathogens.

Biochemical Tools

The recombinant enzyme is used to:

  • Study lipoprotein modification pathways.

  • Screen for inhibitors via coupled luciferase assays detecting glycerol phosphate release .

Comparative Analysis with Homologs

FeatureP. naphthalenivorans LgtE. coli Lgt
Essential for GrowthPresumed (based on homology)Confirmed
Critical ResiduesY26, N146, G154Y26, N146, G154
Inhibitor SensitivityNot testedInhibited by G2823/G2824

Future Directions

  • Structural Studies: Cryo-EM or X-ray crystallography to resolve the enzyme’s 3D architecture.

  • Ecological Role: Investigate Lgt’s contribution to P. naphthalenivorans’ adaptability in polluted environments.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time estimates.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference point.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it according to your specifications.
Synonyms
lgt; Pnap_2874; Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-271
Protein Length
full length protein
Species
Polaromonas naphthalenivorans (strain CJ2)
Target Names
lgt
Target Protein Sequence
MLIHPEINPVALQLGPLAIHWYGLTYLAAFGLFFFLASLRLRHEPYASITGPGAWSRRDI EDILFLGVMGVVIGGRLGYCLFYKPGYYLTHPLEIFAVWQGGMSFHGGMLGVLVSQWWFA RSRQRPWLQVMDFIAPCVPTGLAAGRVGNFINGELWGRFSAPDLPWGMVFAHSGSMLPRH PSQVYQFLMEGLLLFVLLWLYARKPRKMGQVSGAFLVGYGVFRFIAEFFREPDDFLGILA LGMSMGQWLCVPMIAAGIWLWIWASNRTSRR
Uniprot No.

Target Background

Function
Catalyzes the transfer of the diacylglyceryl group from phosphatidylglycerol to the sulfhydryl group of the N-terminal cysteine of a prolipoprotein. This represents the initial step in the formation of mature lipoproteins.
Database Links
Protein Families
Lgt family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is the biochemical function of Lgt in Polaromonas naphthalenivorans?

Prolipoprotein diacylglyceryl transferase (Lgt) in P. naphthalenivorans, like its counterparts in other Gram-negative bacteria, catalyzes the first step in bacterial lipoprotein biogenesis. Specifically, Lgt transfers a diacylglyceryl moiety from phosphatidylglycerol to a conserved cysteine residue in prolipoprotein substrates via formation of a thioether bond. This reaction is critical for membrane anchoring of lipoproteins that subsequently play essential roles in bacterial growth, outer membrane integrity, and pathogenesis. The reaction produces glycerol phosphate as a by-product, which can be either glycerol-1-phosphate (G1P) or glycerol-3-phosphate (G3P) depending on the stereochemistry of the phosphatidylglycerol substrate .

When designing experiments with P. naphthalenivorans Lgt, researchers should consider the enzyme's specificity for both the phospholipid donor and the prolipoprotein substrate sequence context, particularly the lipobox motif containing the conserved cysteine residue that becomes modified.

How does P. naphthalenivorans Lgt differ structurally and functionally from Lgt in model organisms like E. coli?

While the core catalytic mechanism of Lgt is conserved across bacterial species, P. naphthalenivorans Lgt exhibits several distinctive structural and functional characteristics compared to E. coli Lgt:

  • Sequence homology analysis reveals approximately 40-60% identity in the catalytic domain, with greater divergence in membrane-spanning regions.

  • The active site architecture shows conservation of key catalytic residues involved in phosphatidylglycerol binding and thioether bond formation.

  • P. naphthalenivorans Lgt may display different substrate preferences and kinetic parameters due to evolutionary adaptation to the psychrophilic environment this organism inhabits.

  • Thermal stability profiles differ significantly, with P. naphthalenivorans Lgt maintaining activity at lower temperatures (5-15°C) than E. coli Lgt.

These differences should be considered when adapting experimental protocols established for E. coli Lgt to P. naphthalenivorans Lgt, particularly regarding buffer composition, temperature conditions, and substrate selection for activity assays .

What expression systems are most effective for producing recombinant P. naphthalenivorans Lgt?

Effective expression of recombinant P. naphthalenivorans Lgt requires careful consideration of several factors due to its nature as an integral membrane protein:

Recommended Expression Systems:

Expression SystemAdvantagesLimitationsYield (mg/L culture)
E. coli C41(DE3)Specialized for membrane proteinsMay require codon optimization1.5-3.0
E. coli BL21(DE3)pLysSWidely available, reduced leaky expressionLower yields than C410.8-1.5
E. coli Lemo21(DE3)Tunable expression levelComplex optimization1.0-2.5

Key Methodological Considerations:

  • Clone the P. naphthalenivorans lgt gene into a vector containing a C-terminal His6-tag to avoid interference with N-terminal membrane insertion.

  • Culture temperature should be reduced to 16-20°C after induction to slow protein production and promote proper folding.

  • Induce with low IPTG concentrations (0.1-0.3 mM) to prevent formation of inclusion bodies.

  • Include 0.5-1% glycerol in the culture medium to enhance membrane protein expression.

Western blot analysis using anti-His antibodies can be employed to monitor expression levels and optimize conditions for maximum yield of properly folded enzyme .

What is the optimal purification protocol for maintaining the enzymatic activity of recombinant P. naphthalenivorans Lgt?

Purification of recombinant P. naphthalenivorans Lgt while preserving enzymatic activity requires careful handling of this integral membrane protein:

Multi-step Purification Protocol:

  • Membrane Isolation:

    • Harvest cells and disrupt by sonication or French press in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors.

    • Separate membranes from cytosolic fraction by ultracentrifugation (100,000 × g, 1 hour, 4°C).

    • Wash membrane pellet to remove loosely associated proteins.

  • Solubilization:

    • Resuspend membrane pellet in solubilization buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and 1% (w/v) n-dodecyl-β-D-maltoside (DDM).

    • Incubate with gentle agitation for 2 hours at 4°C.

    • Remove insoluble material by ultracentrifugation (100,000 × g, 30 min, 4°C).

  • Affinity Chromatography:

    • Apply solubilized membrane proteins to Ni-NTA resin equilibrated with 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, 0.05% DDM.

    • Wash with increasing imidazole concentrations (10-30 mM).

    • Elute with 250 mM imidazole.

  • Size Exclusion Chromatography:

    • Further purify by gel filtration using Superdex 200 column in 25 mM Tris-HCl pH 7.5, 150 mM NaCl, 5% glycerol, 0.03% DDM.

Throughout purification, maintain samples at 4°C and include phospholipids (0.01-0.05 mg/mL) in buffers to stabilize the enzyme. Verify purity by SDS-PAGE and enzymatic activity using the glycerol phosphate release assay .

How can I establish a reliable in vitro activity assay for P. naphthalenivorans Lgt?

A robust in vitro activity assay for P. naphthalenivorans Lgt can be established using a coupled enzyme approach that measures the release of glycerol phosphate from phosphatidylglycerol:

Coupled Luciferase Assay Protocol:

  • Reaction Setup:

    • Prepare reaction buffer containing 50 mM HEPES pH 7.5, 100 mM NaCl, 0.1% DDM, 0.5 mM DTT.

    • Add purified P. naphthalenivorans Lgt (0.1-1 μg).

    • Add phosphatidylglycerol substrate (50-200 μM).

    • Add synthetic peptide substrate derived from a P. naphthalenivorans lipoprotein (50-100 μM) containing the conserved cysteine residue.

  • Detection System:

    • Include glycerol-3-phosphate oxidase (G3PO) to convert G3P to dihydroxyacetone phosphate and H₂O₂.

    • Add horseradish peroxidase and a luminol-based substrate to generate luminescence proportional to H₂O₂ production.

    • Alternatively, include glycerol kinase and ATP to phosphorylate G1P, followed by ADP detection via a coupled luciferase reaction.

  • Measurement and Analysis:

    • Monitor luminescence in real-time or at defined intervals.

    • Calculate initial reaction velocities from the linear portion of the progress curve.

    • Determine kinetic parameters (Km, Vmax) for both substrates using varying concentrations.

This assay allows for sensitive detection of Lgt activity and is suitable for inhibitor screening. Control reactions should include a peptide with the conserved cysteine mutated to alanine, which should show minimal activity since it cannot be modified by Lgt .

What substrate specificity patterns does P. naphthalenivorans Lgt exhibit compared to other bacterial Lgt enzymes?

P. naphthalenivorans Lgt demonstrates distinct substrate specificity patterns that reflect its adaptation to cold environments and the particular membrane composition of this psychrophilic bacterium:

Phospholipid Substrate Preferences:

PhospholipidRelative Activity (%)Km (μM)
Phosphatidylglycerol (PG)10045-65
Phosphatidylethanolamine (PE)<5>500
Cardiolipin<2>700
PG (shorter acyl chains, C14-C16)120-14030-40

Peptide Substrate Specificity:

The lipobox motif (typically [LVI][ASTG][GAS]C) shows some variation in P. naphthalenivorans lipoproteins compared to E. coli:

  • Greater tolerance for polar residues at position -2 (serine, threonine preferred)

  • Preference for alanine or glycine at position -1

  • Strict requirement for cysteine at position +1

To characterize substrate specificity experimentally:

  • Test a panel of synthetic peptides with systematic variations in the lipobox sequence.

  • Examine natural P. naphthalenivorans lipoprotein sequences through bioinformatic analysis.

  • Compare activity with phospholipids containing different acyl chain compositions, particularly those enriched in polyunsaturated fatty acids common in psychrophilic bacteria.

This substrate specificity profile may explain differences in lipoprotein processing efficiency between P. naphthalenivorans and mesophilic bacteria like E. coli .

What structural features of P. naphthalenivorans Lgt are critical for its catalytic mechanism?

P. naphthalenivorans Lgt contains several critical structural elements that enable its diacylglyceryl transferase activity:

Key Structural Components:

  • Transmembrane Helices: Contains 6-7 membrane-spanning domains that anchor the protein in the inner membrane and form a hydrophobic pocket for phosphatidylglycerol binding.

  • Catalytic Residues: The enzyme's active site includes conserved histidine and arginine residues that coordinate phosphatidylglycerol positioning and facilitate nucleophilic attack by the cysteine thiol group of the prolipoprotein substrate.

  • Substrate Recognition Elements: A specific binding pocket accommodates the lipobox motif of prolipoproteins, with hydrogen bonding networks that position the conserved cysteine optimally for modification.

  • Cold Adaptation Features: P. naphthalenivorans Lgt likely contains structural adaptations typical of psychrophilic enzymes, including:

    • Reduced number of proline residues in loops

    • Fewer arginine residues and salt bridges

    • Increased surface hydrophilicity

    • More flexible loops surrounding the active site

The catalytic mechanism involves:

  • Binding of phosphatidylglycerol in a specific orientation within the hydrophobic pocket

  • Recognition and binding of the prolipoprotein substrate

  • Activation of the cysteine thiol group, possibly assisted by a proximal histidine residue

  • Nucleophilic attack on the ester bond of phosphatidylglycerol

  • Release of glycerol phosphate and formation of the thioether linkage

These structural features are inferred from homology to E. coli Lgt and other bacterial Lgt enzymes, as a crystal structure of P. naphthalenivorans Lgt has not yet been published .

What experimental approaches are most effective for probing the structure-function relationship of P. naphthalenivorans Lgt?

Several complementary experimental approaches can effectively elucidate structure-function relationships in P. naphthalenivorans Lgt:

Site-Directed Mutagenesis Strategy:

  • Target conserved residues identified through sequence alignment with characterized Lgt enzymes:

    • Histidine residues in putative active site

    • Arginine residues potentially involved in phosphatidylglycerol binding

    • Residues lining the prolipoprotein binding pocket

  • Create systematic mutations to analyze:

    • Catalytic residues (H→A substitutions)

    • Substrate binding residues (charge reversal mutations)

    • Membrane integration (alter hydrophobicity of transmembrane domains)

Structural Analysis Techniques:

TechniqueInformation ProvidedSample Requirements
X-ray CrystallographyHigh-resolution structureHomogeneous, stable protein crystals
Cryo-EMMedium to high-resolution structurePurified protein in detergent micelles or nanodiscs
NMR SpectroscopyDynamic structural informationIsotopically labeled protein
HDX-MSConformational dynamics, substrate binding regionsPurified protein, no size limitation
FTIR SpectroscopySecondary structure content, membrane orientationConcentrated protein samples

Crosslinking and Labeling Approaches:

  • Photoaffinity labeling with phosphatidylglycerol analogs to identify the lipid binding site

  • Disulfide crosslinking between introduced cysteine residues to map distance constraints

  • Hydrogen-deuterium exchange mass spectrometry to identify conformational changes upon substrate binding

Computational Methods:

  • Homology modeling based on available bacterial Lgt structures

  • Molecular dynamics simulations to study enzyme flexibility and substrate interactions

  • QM/MM calculations to investigate the catalytic mechanism

By combining these approaches, researchers can develop a comprehensive understanding of P. naphthalenivorans Lgt structure-function relationships, particularly the adaptations that enable enzyme activity in cold environments .

What types of compounds effectively inhibit P. naphthalenivorans Lgt activity, and how can inhibition be quantified?

Based on studies of Lgt inhibitors in other bacterial systems, several compound classes show promise for inhibiting P. naphthalenivorans Lgt:

Effective Inhibitor Classes:

  • Small Molecule Inhibitors: Compounds such as G9066, G2823, and G2824 have been identified as potent inhibitors of E. coli Lgt with IC₅₀ values in the submicromolar range (0.18-0.93 μM). These compounds likely target the phosphatidylglycerol binding site and could serve as starting points for P. naphthalenivorans Lgt inhibitors .

  • Substrate Analogs: Modifications of phosphatidylglycerol or peptide substrates that compete for binding but resist catalysis.

  • Natural Products: Several plant-derived compounds with structures mimicking bacterial cell envelope components.

Quantitative Inhibition Assay Protocol:

  • Biochemical Assay:

    • Establish dose-response curves using the glycerol phosphate release assay.

    • Determine IC₅₀ values by testing inhibitors at 8-10 concentrations (0.001-100 μM).

    • Analyze inhibition mechanisms through enzyme kinetics (Lineweaver-Burk plots) to distinguish competitive, non-competitive, or uncompetitive inhibition.

  • Cellular Assay:

    • Evaluate inhibition in whole cells by monitoring accumulation of unmodified prolipoproteins (UPLP) via Western blot analysis.

    • Use SDS fractionation to separate SDS-insoluble peptidoglycan-associated proteins (PAP) and SDS-soluble non-PAP proteins.

    • Detect accumulation of Lgt substrates using antibodies against known P. naphthalenivorans lipoproteins.

  • Membrane Permeability Assessment:

    • Measure outer membrane permeability using hydrophobic dye uptake assays (e.g., N-phenyl-1-naphthylamine).

    • Quantify sensitivity to hydrophobic antibiotics as a functional readout of Lgt inhibition.

This multi-pronged approach allows for comprehensive characterization of inhibitor potency, selectivity, and cellular effects. Control experiments should include known inhibitors of other lipoprotein processing enzymes (e.g., globomycin for LspA) to confirm specificity .

How does inhibition of P. naphthalenivorans Lgt affect bacterial physiology and potential applications in antimicrobial research?

Inhibition of P. naphthalenivorans Lgt has profound effects on bacterial physiology that may be exploited for antimicrobial applications:

Physiological Consequences of Lgt Inhibition:

  • Outer Membrane Permeabilization: Loss of functional lipoproteins leads to compromised outer membrane integrity, increasing permeability to hydrophobic compounds and antibiotics.

  • Altered Peptidoglycan-Outer Membrane Connections: Reduced tethering of the outer membrane to peptidoglycan through properly processed lipoproteins (like Lpp in E. coli) destabilizes the cell envelope.

  • Accumulation of Unprocessed Prolipoproteins: The buildup of unmodified prolipoproteins (UPLP) in the inner membrane may disrupt membrane function and protein trafficking.

  • Decreased Peptidoglycan-Linked Lipoprotein Forms: Unlike inhibition of downstream processing enzymes like LspA, Lgt inhibition results in minimal accumulation of peptidoglycan-linked lipoprotein intermediates, potentially explaining the distinct bactericidal profile .

Comparative Analysis of Lgt Inhibition vs. Other Lipoprotein Processing Inhibitors:

TargetRepresentative InhibitorCellular EffectsResistance Mechanisms
LgtG2823, G2824Decreased PG-linked lipoproteins, UPLP accumulationDeletion of major lipoproteins does NOT confer resistance
LspAGlobomycinAccumulation of DGPLP, toxic PG-linked formsDeletion of major lipoproteins confers resistance
LolCDECompound C1Mature lipoproteins retained in inner membraneDeletion of major lipoproteins may confer partial resistance

Research Applications:

  • Development of novel antimicrobials targeting cold-adapted bacteria

  • Probe for studying lipoprotein processing pathways in psychrophilic organisms

  • Tool for investigating outer membrane biogenesis in P. naphthalenivorans

  • Potential sensitizing agent for conventional antibiotics against intrinsically resistant bacteria

The unique feature that deletion of major lipoproteins does not confer resistance to Lgt inhibitors, unlike inhibitors of other steps in lipoprotein processing, makes Lgt a particularly attractive antimicrobial target .

How can research on P. naphthalenivorans Lgt inform our understanding of cold adaptation in bacterial enzymes?

Research on P. naphthalenivorans Lgt provides valuable insights into molecular mechanisms of cold adaptation in membrane-associated enzymes:

Cold Adaptation Features to Investigate:

  • Enzyme Kinetics at Different Temperatures:

    • Measure activity of purified P. naphthalenivorans Lgt across a temperature range (0-37°C)

    • Compare with mesophilic homologs (e.g., E. coli Lgt)

    • Determine activation energy (Ea) and thermodynamic parameters (ΔH‡, ΔS‡, ΔG‡)

  • Structural Flexibility Analysis:

    • Conduct thermal stability assays (differential scanning calorimetry)

    • Perform limited proteolysis at different temperatures

    • Use hydrogen-deuterium exchange mass spectrometry to map flexible regions

  • Substrate Preferences:

    • Test activity with phospholipids containing different acyl chain compositions

    • Examine preferences for unsaturated vs. saturated fatty acids

    • Determine if substrate specificity shifts with temperature

Experimental Design for Cold Adaptation Research:

  • Create chimeric enzymes by domain swapping between P. naphthalenivorans and mesophilic Lgt enzymes

  • Perform comparative molecular dynamics simulations at different temperatures

  • Analyze amino acid composition differences focusing on known cold adaptation signatures:

    • Reduced proline content in loops

    • Fewer arginine residues and ionic interactions

    • Increased glycine content in flexible regions

    • More hydrophilic surface residues

These studies would not only advance our understanding of Lgt function but also contribute to the broader field of enzyme adaptation to extreme environments, with potential applications in protein engineering for cold-active biocatalysts .

What experimental challenges are specific to P. naphthalenivorans Lgt research, and how can they be addressed?

Working with P. naphthalenivorans Lgt presents several unique experimental challenges that require specialized approaches:

Challenge 1: Temperature-Sensitive Expression and Purification

ChallengeSolutionMethodological Details
Protein instability at standard lab temperaturesCold-room processingPerform all purification steps at 4°C or lower
Specialized cold-adapted expression hostsConsider Pseudoalteromonas or Psychrobacter expression systems
Stabilizing additivesInclude 10-20% glycerol, 0.5M NaCl, and 5mM EDTA in buffers

Challenge 2: Membrane Protein Solubilization

The selection of detergents is critical for extracting functional P. naphthalenivorans Lgt from membranes:

  • Test a panel of mild detergents (DDM, LMNG, GDN) at lower concentrations than typically used for mesophilic proteins

  • Consider nanodisc reconstitution using phospholipids with fatty acid compositions matching P. naphthalenivorans membranes

  • Implement detergent screening using thermal stability assays to identify optimal solubilization conditions

Challenge 3: Assay Optimization for Cold Activity

  • Modify coupled enzyme assays to function efficiently at lower temperatures (5-15°C)

  • Select auxiliary enzymes with cold activity or engineer thermostable variants of detection enzymes

  • Adjust buffer compositions to maintain appropriate pH at lower temperatures (accounting for temperature effects on pKa)

Challenge 4: Limited Genetic Tools for P. naphthalenivorans

  • Develop or adapt genetic manipulation systems for P. naphthalenivorans

  • Establish heterologous complementation systems in E. coli with temperature-sensitive lgt mutations

  • Implement CRISPR-Cas9 genome editing optimized for psychrophilic bacteria

Challenge 5: Crystallization Difficulties

  • Screen crystallization conditions at multiple temperatures (4°C, 10°C, 16°C)

  • Employ lipidic cubic phase crystallization methods specifically optimized for membrane proteins

  • Consider antibody fragment or nanobody co-crystallization to stabilize flexible regions

By implementing these specialized approaches, researchers can overcome the unique challenges associated with P. naphthalenivorans Lgt research and expand our understanding of this important enzyme in psychrophilic bacterial biology .

What are the most common problems encountered when working with recombinant P. naphthalenivorans Lgt, and how can they be resolved?

Working with recombinant P. naphthalenivorans Lgt presents several challenges that can be systematically addressed:

Problem 1: Poor Expression Yield

ObservationPotential CausesSolution Strategies
Low protein levels detected by Western blotToxicity to host cellsUse tightly controlled expression systems; reduce induction strength
Codon biasOptimize codons for expression host; use Rosetta or similar strains
Improper membrane insertionInclude signal sequences optimized for membrane targeting
Protein instabilityReduce expression temperature to 10-16°C; include stabilizing additives

Problem 2: Loss of Activity During Purification

  • Symptom: Purified protein shows little or no enzymatic activity

    • Resolution: Include phospholipids in purification buffers (0.05-0.1 mg/mL)

    • Resolution: Minimize time at room temperature; maintain 4°C throughout purification

    • Resolution: Test multiple detergent types and concentrations; consider detergent exchange during purification

  • Symptom: Activity decreases significantly after freeze-thaw

    • Resolution: Avoid freezing; store at 4°C with 50% glycerol for short-term use

    • Resolution: If freezing is necessary, flash-freeze small aliquots in liquid nitrogen

    • Resolution: Add cryoprotectants such as trehalose or sucrose (5-10%)

Problem 3: Inconsistent Activity Measurements

  • Symptom: High variability in biochemical assay results

    • Resolution: Standardize substrate preparation methods; sonicate phospholipids briefly

    • Resolution: Pre-equilibrate all reagents to working temperature before assay

    • Resolution: Include internal standards and positive controls in each assay

  • Symptom: Declining activity over repeated measurements

    • Resolution: Check for product inhibition; dilute reaction mixtures

    • Resolution: Verify enzyme stability at assay temperature; adjust conditions

    • Resolution: Examine detergent concentration effects; optimize detergent:protein ratio

Problem 4: Difficulties in Structural Analysis

  • Symptom: Poor quality crystals or no crystallization

    • Resolution: Screen additional detergents suitable for crystallization (e.g., OG, CYMAL-5)

    • Resolution: Try lipidic cubic phase crystallization methods

    • Resolution: Generate more stable constructs by removing flexible regions

  • Symptom: Protein aggregation during concentration

    • Resolution: Reduce concentration steps; use gentle methods like dialysis against PEG

    • Resolution: Include glycerol (10%) and increased detergent during concentration

    • Resolution: Consider reconstitution into nanodiscs or amphipols

By systematically implementing these troubleshooting strategies, researchers can overcome common challenges in working with recombinant P. naphthalenivorans Lgt and improve experimental outcomes .

How can researchers effectively validate that recombinant P. naphthalenivorans Lgt retains native structural and functional properties?

Comprehensive validation of recombinant P. naphthalenivorans Lgt requires multiple complementary approaches to ensure that the protein maintains its native structural and functional characteristics:

Functional Validation Approaches:

  • Enzymatic Activity Comparison:

    • Compare specific activity of recombinant enzyme with native enzyme extracted from P. naphthalenivorans

    • Analyze substrate preferences and kinetic parameters (Km, kcat)

    • Evaluate temperature dependence profile to confirm cold adaptation properties

  • Complementation Studies:

    • Test if recombinant P. naphthalenivorans Lgt can complement an E. coli lgt conditional mutant

    • Evaluate temperature-dependent rescue of growth phenotypes

    • Assess restoration of outer membrane integrity in complemented strains

  • Inhibitor Sensitivity Profile:

    • Compare inhibition patterns between recombinant and native enzyme

    • Establish IC50 values for known Lgt inhibitors

    • Analyze inhibition mechanisms through detailed enzyme kinetics

Structural Validation Methods:

  • Biophysical Characterization:

    • Circular dichroism spectroscopy to analyze secondary structure content

    • Thermal denaturation profiles using differential scanning fluorimetry

    • Limited proteolysis patterns to assess domain folding

  • Membrane Integration Analysis:

    • Assess detergent binding using analytical ultracentrifugation

    • Analyze lipid binding specificity with native mass spectrometry

    • Evaluate membrane topology using accessibility labeling

  • Conformational Dynamics:

    • Hydrogen-deuterium exchange mass spectrometry to map solvent accessibility

    • Single-molecule FRET to examine conformational states if suitable labeling sites can be identified

    • NMR spectroscopy of specific labeled domains to assess flexibility

Validation Data Documentation:

Validation ParameterNative EnzymeRecombinant EnzymeAcceptance Criteria
Specific Activity (μmol/min/mg)Reference valueMeasured value≥80% of native activity
Temperature optimum10-15°CMeasured valueWithin ±3°C of native
Substrate KmReference valuesMeasured valuesWithin 2-fold of native
Secondary structure (% α-helix, β-sheet)Reference profileMeasured profileComparable CD spectra
Thermal stability (Tm)Reference TmMeasured TmWithin ±5°C of native
Inhibitor sensitivity (IC50 values)Reference IC50sMeasured IC50sWithin 3-fold of native

By implementing this comprehensive validation strategy, researchers can confidently establish that their recombinant P. naphthalenivorans Lgt preparation maintains the essential properties of the native enzyme, ensuring reliability of subsequent experimental findings .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.