Recombinant Polaromonas naphthalenivorans Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Molecular Architecture

Expression and Purification

ParameterDetail
Expression SystemE. coli BL21(DE3)
VectorpET-28a(+)
Induction Condition0.5 mM IPTG at 18°C for 20 hr
Purification MethodImmobilized Metal Affinity Chromatography
Final Purity>90% (SDS-PAGE verified)
Yield8-12 mg/L culture

The recombinant protein shows optimal solubility in Tris-based buffers (pH 7.5-8.5) with 150-300 mM NaCl . Lyophilized formulations maintain stability for >12 months at -80°C when stored with 6% trehalose cryoprotectant .

Functional Characteristics

Biochemical Activity Profile

  • Substrate Preference: Cleaves unfolded proteins >30 kDa at hydrophobic residues

  • Temperature Optima: 45°C (retains 80% activity at 55°C for 30 min)

  • pH Stability: Active in pH 6.0-9.0 (peak activity at pH 7.2)

  • Inhibitor Sensitivity:

    • 1 mM EDTA: Complete inhibition

    • 5 mM PMSF: No effect

    • 0.1 mM Bestatin: 40% activity reduction

Kinetic studies using FRET substrates (Abz-GGFLRRV-EDDnp) revealed k<sub>cat</sub>/K<sub>M</sub> = 2.1 × 10<sup>4</sup> M<sup>-1</sup>s<sup>-1</sup>, indicating moderate catalytic efficiency compared to homologous bacterial proteases .

Research Applications

  • Protein Misfolding Studies: Used to digest aggregation-prone substrates in chaperone-protease interaction assays

  • Structural Biology: Crystallized in complex with zinc ions (PDB ID pending)

  • Industrial Enzymes: Thermostable properties under evaluation for detergent formulations

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
htpX; Pnap_3448; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Polaromonas naphthalenivorans (strain CJ2)
Target Names
htpX
Target Protein Sequence
MKRILLFILTNVAVVAVLGIVASLLGVNRFLTANGLNLSALLGFALIMGFGGAIISLLIS KPVAKWSAGVRLINDPQNADEAWIVETVRRLADKAQIGMPEVGIFEGEPNAFATGAFKNS SLVAVSTGLLQGMTKEEIEAVLGHEIAHVANGDMVTMTLIQGVMNTFVVFLSRVIGYAVD SFLRKGDSNSSGPGIGYYVSTIVLDIVLGFAAAIVVAWFSRHREFRADAGAAQLMGRKQP MMNALARLGGMQPGELPKAVEAMGITGSIGKLFATHPPIEERIAALQNAQG
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

How does the Polaromonas naphthalenivorans HtpX homolog compare to HtpX proteases in other bacterial species?

The HtpX homolog from Polaromonas naphthalenivorans shares functional similarities with other bacterial HtpX proteases, particularly the well-studied Escherichia coli HtpX. Both are M48 family zinc metalloproteinases located in the cytoplasmic membrane and likely participate in protein quality control mechanisms .

The functional conservation across bacterial species suggests evolutionary importance of this protease family in membrane protein homeostasis, though species-specific roles may exist depending on the organism's environmental niche.

What expression systems are recommended for producing recombinant Polaromonas naphthalenivorans HtpX homolog?

For optimal expression of Polaromonas naphthalenivorans HtpX homolog, E. coli-based expression systems are commonly employed. When designing your expression strategy, consider the following methodological approach:

Signal Peptide Selection:
Since HtpX is a membrane protein, the choice of signal peptide is critical for proper targeting and folding. Consider testing multiple signal peptides such as DsbA, OmpA, PhoA, or Hbp, as each may result in different expression efficiencies . The signal peptide architecture consists of:

  • Positively charged N-terminal region (n-region)

  • Hydrophobic core (h-region)

  • Polar C-terminal region (c-region) containing an AXA motif recognized by LepB

Expression Tuning:
Rather than maximizing expression, optimize translational levels to balance protein production with the capacity of the secretory apparatus . This can be achieved by:

  • Modifying the translational initiation region (TIR) while maintaining the amino acid sequence

  • Using inducible promoters with titratable expression systems (e.g., rhamnose-inducible promoter)

  • Adjusting inducer concentrations to find the optimal expression window

Table 1: Comparative Efficiency of Signal Peptides for Membrane Protein Expression

Signal PeptideTargeting PathwayHydrophobicitySuitable for
DsbACo-translational (SRP)HighProteins prone to cytoplasmic aggregation
OmpAPost-translational (SecB)ModerateSlower-folding proteins
PhoAPost-translational (SecB)ModerateProteins requiring periplasmic folding
STIIPost-translational (SecB)VariableTunable expression with modified TIR

A combinatorial screening approach testing different signal peptides at various inducer concentrations is recommended to determine optimal expression conditions .

What are the most effective methods for measuring the proteolytic activity of recombinant Polaromonas naphthalenivorans HtpX homolog?

Measuring the proteolytic activity of recombinant Polaromonas naphthalenivorans HtpX homolog requires specialized approaches due to its membrane-associated nature and limited knowledge of physiological substrates. Based on methodologies developed for E. coli HtpX, the following approaches are recommended:

In Vivo Assay System:
A semiquantitative and convenient protease activity assay can be adapted from the E. coli HtpX model. This approach involves:

  • Construction of a model substrate containing:

    • A domain recognizable by HtpX

    • A reporter domain for easy detection (e.g., fluorescent protein or enzymatic reporter)

    • A linker region containing the putative cleavage site

  • Co-expression of the model substrate with wild-type or mutant HtpX variants

  • Quantification of substrate cleavage through methods such as:

    • Western blotting to detect fragment patterns

    • Fluorescence assays if using fluorescent reporters

    • Enzymatic activity measurements if using enzymatic reporters

In Vitro Reconstitution:
For more controlled biochemical characterization:

  • Purify the recombinant HtpX in detergent micelles or nanodiscs to maintain its native conformation

  • Design synthetic peptide substrates based on predicted cleavage sites

  • Monitor proteolytic activity through:

    • HPLC analysis of peptide fragments

    • Mass spectrometry to identify cleavage sites

    • Fluorescence resonance energy transfer (FRET)-based assays using labeled peptides

This assay system enables detection of differential protease activities between wild-type HtpX and mutants carrying mutations in conserved regions, allowing structure-function relationship studies .

How can site-directed mutagenesis be used to investigate the catalytic mechanism of Polaromonas naphthalenivorans HtpX homolog?

Site-directed mutagenesis is a powerful approach for investigating the catalytic mechanism of Polaromonas naphthalenivorans HtpX homolog. Based on the classification as an M48 family zinc metalloproteinase, the following methodological strategy is recommended:

Identification of Key Residues:
First, identify conserved residues likely involved in catalysis through:

  • Multiple sequence alignment with well-characterized M48 proteases

  • Structural prediction using homology modeling

  • Identification of the HEXXH motif typical of zinc metalloproteinases and other conserved residues

Mutagenesis Strategy:
Design mutations targeting:

  • Zinc-coordinating residues (typically histidines in the HEXXH motif)

  • Catalytic glutamate residue

  • Substrate-binding pocket residues

  • Residues potentially involved in conformational changes

Activity Assessment:
Using the in vivo assay system described previously, evaluate:

  • The effect of each mutation on proteolytic activity

  • Changes in substrate specificity

  • Alterations in kinetic parameters

Table 2: Suggested Mutations and Their Expected Effects

Target ResidueSuggested MutationExpected EffectRationale
His in HEXXH motifHis→AlaLoss of activityDisrupts zinc coordination
Glu in HEXXH motifGlu→GlnReduced activityMaintains structure but alters catalysis
Conserved Asp/GluAsp/Glu→Asn/GlnAltered activityTests role in substrate binding or catalysis
Hydrophobic pocketLeu/Ile/Val→AlaChanged specificityModifies substrate binding pocket
Conserved GlyGly→AlaRestricted flexibilityTests importance of conformational changes

This systematic mutagenesis approach would not only elucidate the catalytic mechanism but also provide insights into substrate recognition and specificity determinants .

What strategies can address challenges in solubilizing and purifying functional Polaromonas naphthalenivorans HtpX homolog?

Solubilizing and purifying functional membrane proteins like Polaromonas naphthalenivorans HtpX homolog presents significant challenges. A methodological approach to address these challenges includes:

Optimized Membrane Extraction:

  • Test different detergents for efficient extraction:

    • Mild detergents (DDM, LMNG) to maintain native structure

    • Zwitterionic detergents (CHAPS, FC-16) for efficient solubilization

    • Detergent mixtures for optimal balance between extraction and activity

  • Screen solubilization conditions systematically:

    • Detergent concentration gradients

    • pH variations (typically pH 7.0-8.5)

    • Salt concentrations (100-500 mM NaCl)

    • Addition of glycerol (5-10%) to stabilize the protein

Purification Strategy:

  • Affinity chromatography using carefully positioned tags that don't interfere with folding or activity

  • Size exclusion chromatography to ensure homogeneity and remove aggregates

  • Ion exchange chromatography as a polishing step if necessary

Alternative Approaches:

  • Nanodiscs or liposome reconstitution to maintain a lipid environment

  • Fusion to solubility-enhancing partners (e.g., MBP) with cleavable linkers

  • Cell-free expression systems with direct incorporation into artificial membranes

Activity Preservation:

  • Include zinc ions (10-100 μM) in all buffers to maintain the active site

  • Add protease inhibitors selectively (avoid metalloprotease inhibitors)

  • Minimize time between extraction and activity assays

  • Store with appropriate additives (glycerol, reducing agents) at -80°C

Table 3: Detergent Screening Guide for HtpX Homolog Purification

DetergentCMC (%)Recommended Working ConcentrationExpected Outcome
DDM0.00870.5-1% for extraction, 0.05% for purificationGentle extraction, maintains activity
LMNG0.0010.1-0.5% for extraction, 0.01% for purificationEnhanced stability, good for crystallization
CHAPS0.491-2% for extraction, 0.5% for purificationEffective solubilization, may decrease activity
Digitonin0.51-2% for extraction, 0.1-0.4% for purificationNative-like environment, expensive
SMA CopolymerN/A2.5% for direct extractionExtracts with native lipids, limited compatibility

By systematically optimizing these conditions, researchers can obtain functionally active Polaromonas naphthalenivorans HtpX homolog suitable for biochemical and structural studies.

How can I design experiments to identify physiological substrates of Polaromonas naphthalenivorans HtpX homolog?

Identifying physiological substrates of Polaromonas naphthalenivorans HtpX homolog requires a multi-faceted experimental approach. The following methodological strategy is recommended:

Comparative Proteomics Approach:

  • Generate an HtpX knockout strain of Polaromonas naphthalenivorans

  • Compare the membrane proteome of wild-type and knockout strains using:

    • 2D gel electrophoresis followed by mass spectrometry

    • Label-free quantitative proteomics

    • SILAC (Stable Isotope Labeling with Amino acids in Cell culture) for improved quantification

  • Identify proteins that accumulate in the knockout strain, suggesting they are potential substrates

Substrate Trapping Strategy:

  • Generate catalytically inactive HtpX mutants that can still bind but not cleave substrates

  • Express tagged versions of these mutants in Polaromonas naphthalenivorans

  • Perform co-immunoprecipitation followed by mass spectrometry identification

  • Validate candidate interactions using recombinant proteins

In Vitro Substrate Verification:

  • Express and purify candidate substrates

  • Perform in vitro cleavage assays with purified HtpX

  • Identify cleavage sites using mass spectrometry

  • Determine kinetic parameters for substrate processing

In Vivo Validation:

  • Generate reporter constructs fusing candidate substrates to fluorescent proteins

  • Monitor degradation rates in wild-type versus HtpX knockout strains

  • Perform complementation studies with wild-type and mutant HtpX

Table 4: Statistical Analysis of Proteomic Changes in ΔhtpX Strains

Analysis TypeStatistical MethodSignificance ThresholdFalse Discovery Consideration
Differential ExpressionStudent's t-test or ANOVAp < 0.05Benjamini-Hochberg correction
Fold ChangeLog2 fold change≥ 1.5Combine with p-value threshold
ReproducibilityCoefficient of variation< 20%Require detection in ≥ 3 replicates
Enrichment AnalysisGene Ontology termsp < 0.01Consider pathway redundancy
Network AnalysisProtein-protein interactionsCombined score > 0.7Validate key interactions

This comprehensive approach would provide strong evidence for physiological substrates and insight into the biological role of HtpX in Polaromonas naphthalenivorans .

What experimental controls should be included when studying the localization and membrane topology of Polaromonas naphthalenivorans HtpX homolog?

When investigating the localization and membrane topology of Polaromonas naphthalenivorans HtpX homolog, rigorous experimental controls are essential for reliable interpretation. The following methodological approach is recommended:

Subcellular Fractionation Controls:

  • Positive control markers for different cellular compartments:

    • Cytoplasm: RNA polymerase or glyceraldehyde-3-phosphate dehydrogenase

    • Inner membrane: SecY or LacY

    • Periplasm: β-lactamase or alkaline phosphatase

    • Outer membrane: OmpA or BamA

  • Cross-contamination assessment:

    • Enzymatic assays specific to each cellular compartment

    • Western blotting for compartment-specific markers in all fractions

    • Electron microscopy to verify membrane fraction purity

Topology Mapping Controls:

  • When using reporter fusions (PhoA, GFP, etc.):

    • Positive controls with known localization (cytoplasmic, periplasmic, transmembrane)

    • Negative controls with inverted orientation

    • Calibration standards with known activity in each compartment

  • For cysteine accessibility methods:

    • Protected cysteines (native cysteines in known positions)

    • Exposed cysteines (engineered at surface-accessible positions)

    • Membrane-impermeable versus permeable labeling reagents

  • For protease protection assays:

    • Digestion of intact cells versus permeabilized cells

    • Titration of protease concentrations

    • Time-course analysis to distinguish protected from accessible domains

Signal Sequence Verification:

  • Signal sequence deletion constructs

  • Signal sequence swapping with known membrane proteins

  • Site-directed mutagenesis of key residues in the signal sequence

Table 5: Strategies for Determining Membrane Protein Topology

MethodPrincipleAdvantagesLimitationsEssential Controls
PhoA/LacZ FusionReporter activity depends on cellular locationEstablished technique, quantitativeMay disrupt foldingKnown cytoplasmic and periplasmic domains
Cysteine AccessibilityChemical modification of engineered cysteinesCan probe specific positionsRequires cysteine-free backgroundMembrane-permeable vs. impermeable reagents
Protease ProtectionDigestion pattern reveals protected domainsWorks with native proteinLimited resolutionVerification of membrane integrity
GFP FluorescenceGFP fluoresces in cytoplasm, not periplasmDirect visualizationLimited to terminal fusionsControls for each cellular compartment
Cryo-EM/X-ray CrystallographyDirect structural determinationHighest resolutionTechnically challengingValidation with biochemical approaches

By implementing these controls, researchers can generate reliable data on the localization and topology of the Polaromonas naphthalenivorans HtpX homolog, providing crucial insights into its functional mechanism .

How should conflicting data about HtpX homolog substrate specificity be reconciled and interpreted?

When confronted with conflicting data regarding the substrate specificity of Polaromonas naphthalenivorans HtpX homolog, a systematic approach to reconciliation and interpretation is essential. The following methodological framework is recommended:

Source Evaluation:

  • Assess methodological differences between studies:

    • Expression systems used (E. coli vs. native organism)

    • Purification methods (detergents, buffer conditions)

    • Assay conditions (pH, temperature, ionic strength)

    • Substrate preparation (recombinant vs. synthetic peptides)

  • Evaluate data quality indicators:

    • Statistical robustness (sample size, p-values, confidence intervals)

    • Technical replicates vs. biological replicates

    • Signal-to-noise ratios in activity assays

    • Appropriate controls (positive, negative, specificity controls)

Reconciliation Approaches:

  • Perform comparative experiments under standardized conditions:

    • Test multiple substrates in parallel

    • Use identical buffer conditions and enzyme concentrations

    • Analyze kinetic parameters (Km, kcat, kcat/Km) rather than single-point measurements

  • Consider biological context:

    • Membrane composition effects on activity

    • Potential cofactors or regulatory proteins

    • Physiological relevance of tested substrates

  • Develop structure-activity relationships:

    • Map cleavage sites from different substrates

    • Identify consensus sequences or structural motifs

    • Use bioinformatics to predict additional substrates

Decision Framework:
When interpreting conflicting data, consider this hierarchical approach:

Table 6: Framework for Resolving Conflicting Substrate Specificity Data

Conflict TypeResolution ApproachValidation MethodInterpretation Guidelines
Substrate preference discrepanciesSide-by-side comparison with activity ratio determinationsCompetition assays with mixed substratesConsider context-dependent specificity
Kinetic parameter variationsRe-determination under identical conditionsMichaelis-Menten analysis with global fittingReport ranges rather than single values
Cleavage site differencesMS/MS sequencing of digestion productsSynthetic peptide variants with systematic mutationsMap recognition elements beyond the cleavage site
Activity in different detergentsReconstitution in defined lipid nanodiscsActivity measurements in consistent membrane environmentConsider native lipid requirements
Expression system variabilityComplementation studies in the native organismGenetic rescue experimentsPrioritize in vivo evidence over in vitro

By employing this structured approach, researchers can systematically address conflicting data and develop a more comprehensive understanding of the true substrate specificity profile of the Polaromonas naphthalenivorans HtpX homolog .

What bioinformatic approaches can predict functional domains and catalytic residues in Polaromonas naphthalenivorans HtpX homolog?

Predicting functional domains and catalytic residues in Polaromonas naphthalenivorans HtpX homolog requires sophisticated bioinformatic analyses. The following methodological workflow is recommended:

Sequence-Based Predictions:

  • Multiple Sequence Alignment (MSA) with diverse HtpX homologs:

    • Use MUSCLE, MAFFT, or T-Coffee algorithms

    • Include experimentally characterized M48 proteases

    • Identify highly conserved residues across evolutionary distance

  • Domain identification:

    • Search against domain databases (Pfam, SMART, InterPro)

    • Recognize transmembrane regions using TMHMM or Phobius

    • Identify signal peptides using SignalP

  • Motif detection:

    • Locate the HEXXH zinc-binding motif characteristic of metalloproteinases

    • Identify additional conserved motifs using MEME or GLAM2

    • Score conservation using metrics like Jensen-Shannon divergence

Structure-Based Predictions:

  • Homology modeling:

    • Identify suitable templates in PDB (other M48 proteases)

    • Generate models using I-TASSER, SWISS-MODEL, or AlphaFold2

    • Validate models using PROCHECK, VERIFY3D, and MolProbity

  • Active site prediction:

    • Identify catalytic residues based on structural alignment with characterized proteases

    • Calculate binding pocket volume and electrostatic surface

    • Dock potential substrates to identify binding modes

  • Molecular dynamics simulations:

    • Assess stability of predicted catalytic triads/tetrads

    • Evaluate conformational changes upon substrate binding

    • Investigate water molecule positions in the active site

Integrated Approach:
Combine methods using the following decision tree:

Table 7: Bioinformatic Prediction Workflow with Confidence Metrics

Analysis LevelMethodsConfidence MetricsIntegration Strategy
Primary SequenceConservation analysis, MSAConservation score >0.8, Coverage >70%Essential first filter
Secondary StructurePSIPRED, JPred4Q3 accuracy >80%Refine domain boundaries
Transmembrane TopologyTMHMM, MEMSAT, PhobiusConsensus of ≥2 methodsDefine membrane orientation
3D StructureAlphaFold2, I-TASSERpLDDT >70, TM-score >0.5Template for further analysis
Active SiteCASTp, SiteMap, ConSurfPocket volume, exposure scorePrioritize residues for mutagenesis
Functional InferenceGene neighborhood, Co-evolutionStatistical coupling analysisPropose interaction partners

For catalytic residue prediction, highest confidence should be assigned to positions that are:

  • Absolutely conserved across diverse species

  • Positioned appropriately in the structural model

  • Match known catalytic patterns for M48 proteases

  • Show coevolutionary relationships with other functional residues

This comprehensive bioinformatic approach provides a solid foundation for experimental validation through site-directed mutagenesis and functional assays .

What are the most promising approaches for determining the three-dimensional structure of Polaromonas naphthalenivorans HtpX homolog?

Determining the three-dimensional structure of membrane proteins like Polaromonas naphthalenivorans HtpX homolog presents significant challenges. The following methodological approaches offer promising strategies:

X-ray Crystallography Optimization:

  • Protein engineering for crystallization:

    • Truncation of flexible regions

    • Introduction of surface mutations to enhance crystal contacts

    • Fusion with crystallization chaperones (T4 lysozyme, BRIL)

    • Antibody fragment (Fab) co-crystallization

  • Crystallization condition screening:

    • Lipidic cubic phase (LCP) for membrane proteins

    • Bicelle and detergent screening matrices

    • Additive screening to improve crystal quality

    • In situ diffraction screening to identify microcrystals

Cryo-Electron Microscopy (Cryo-EM):

  • Sample preparation optimization:

    • Nanodiscs or amphipols to maintain native environment

    • Antibody fragment labeling to increase particle size

    • GraFix method to enhance particle stability

    • Graphene oxide grids to improve particle orientation distribution

  • Data collection and processing:

    • High-resolution direct electron detectors

    • Energy filters to enhance contrast

    • Motion correction algorithms

    • 3D classification to handle conformational heterogeneity

Integrative Structural Biology Approach:

  • Nuclear Magnetic Resonance (NMR) spectroscopy:

    • Selective isotope labeling for specific domains

    • Solid-state NMR for membrane-embedded regions

    • Paramagnetic relaxation enhancement for distance constraints

  • Complementary techniques:

    • Hydrogen-deuterium exchange mass spectrometry (HDX-MS)

    • Cross-linking mass spectrometry (XL-MS)

    • Small-angle X-ray scattering (SAXS)

    • Electron paramagnetic resonance (EPR) spectroscopy

Table 8: Comparison of Structural Determination Methods for HtpX Homolog

MethodResolution PotentialSample RequirementsAdvantagesLimitationsTechnical Considerations
X-ray Crystallography1.5-3.0 ÅWell-diffracting crystals (mg quantities)Atomic resolution possibleCrystallization challengingLCP or bicelle crystallization
Cryo-EM2.5-4.0 Å10-100 μg purified proteinNative environment, conformational statesSize limitations (>100 kDa ideal)Contrast enhancement strategies
Solid-state NMR3.0-5.0 ÅIsotope-labeled protein (mg quantities)Dynamic information, no crystals neededSize limitations, complex data analysisSpecific labeling schemes
Integrative ModelingVariesMultiple datasets from different techniquesCombines strengths of multiple methodsComputational challengesValidation across techniques
AlphaFold2/RoseTTAFold2.0-4.0 Å (predicted)Sequence onlyRapid, requires minimal experimental dataLimited validation for membrane proteinsRefinement with experimental constraints

Based on current technological capabilities, a hybrid approach combining preliminary AlphaFold2 modeling with focused cryo-EM studies and validation by cross-linking mass spectrometry may offer the most efficient path to structural determination of the Polaromonas naphthalenivorans HtpX homolog .

How might genomic and transcriptomic analyses inform our understanding of HtpX homolog function in Polaromonas naphthalenivorans?

Genomic and transcriptomic analyses offer powerful approaches to contextualize the function of HtpX homolog in Polaromonas naphthalenivorans. The following methodological strategy is recommended:

Genomic Context Analysis:

  • Gene neighborhood examination:

    • Identify operons containing htpX

    • Analyze conserved gene clusters across related species

    • Investigate regulatory elements (promoters, operators)

  • Comparative genomics:

    • Phylogenetic profiling to identify co-evolving genes

    • Synteny analysis across Polaromonas species and other proteobacteria

    • Identification of horizontally transferred genomic islands

  • Regulatory network prediction:

    • Identify transcription factor binding sites upstream of htpX

    • Analyze sigma factor recognition sequences

    • Predict small RNA interactions with htpX mRNA

Transcriptomic Approaches:

  • RNA-Seq under various conditions:

    • Normal growth vs. stress conditions (heat, oxidative, membrane)

    • Wild-type vs. htpX knockout strains

    • Different growth phases and nutrient limitations

  • Differential expression analysis:

    • Identify co-regulated genes with htpX

    • Determine stress conditions that induce htpX expression

    • Identify compensatory mechanisms in htpX mutants

  • Advanced transcriptomic techniques:

    • Ribosome profiling to assess translation efficiency

    • RNA structure probing to identify regulatory elements

    • ChIP-Seq to identify transcription factors binding the htpX promoter

Integrated Multi-omics Analysis:

  • Correlation of transcriptomics with:

    • Proteomics data to assess post-transcriptional regulation

    • Metabolomics to identify pathways affected by htpX function

    • Phenotypic assays to link expression patterns with physiological outcomes

Table 9: Transcriptomic Analysis of htpX Expression Under Various Conditions

ConditionExperimental DesignExpected OutcomeAnalytical ApproachBiological Interpretation
Heat Stress37°C vs. 42°C, time courseUpregulation of htpXDESeq2 with time-series analysisHeat shock response role
Membrane StressControl vs. sub-MIC membrane-targeting antibioticsCo-regulation with membrane stress genesWGCNA network analysisMembrane quality control function
Carbon Source VariationGrowth on different carbon sourcesMetabolism-dependent expressionPCA and hierarchical clusteringMetabolic integration
Growth PhaseExponential vs. stationary vs. biofilmPhase-specific expressionStage-specific expression analysisRole in adaptation to growth states
Cold AdaptationStandard vs. low temperature (4-10°C)Expression changes in psychrophilic adaptationGO enrichment of co-regulated genesCold adaptation mechanisms

Potential Data Integration Framework:

  • Construct gene regulatory networks using:

    • Transcription factor binding data

    • Expression correlation matrices

    • Protein-protein interaction networks

  • Develop predictive models:

    • Machine learning to predict conditions requiring HtpX activity

    • Bayesian networks to infer causal relationships

    • Flux balance analysis to assess metabolic impact

This comprehensive genomic and transcriptomic approach would provide crucial context for the cellular role of HtpX homolog in Polaromonas naphthalenivorans, potentially revealing unexpected functions and regulatory mechanisms .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.