Recombinant Polaromonas naphthalenivorans UPF0060 membrane protein Pnap_4944 (Pnap_4944)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Pnap_4944; UPF0060 membrane protein Pnap_4944
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Polaromonas naphthalenivorans (strain CJ2)
Target Names
Pnap_4944
Target Protein Sequence
MELLRLAILFAVTALAEIVGCYLPWLVLKQGKSLLLLVPAAMSLGLFAWLLTLHPSAAGR TYAAYGGMYIAVALGWLRFVDGIALTRWDLSGAAIALVGMAVIVMQPSTT
Uniprot No.

Target Background

Database Links
Protein Families
UPF0060 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What are the optimal storage and handling conditions for Pnap_4944?

To maintain the structural integrity and function of Pnap_4944, follow these methodology-based storage and handling protocols:

  • Initial storage: Store the lyophilized protein at -20°C to -80°C upon receipt.

  • Aliquoting: Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles.

  • Working storage: Working aliquots can be stored at 4°C for up to one week.

  • Reconstitution protocol:

    • Briefly centrifuge the vial prior to opening to bring contents to the bottom

    • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

    • Add glycerol to a final concentration of 5-50% (50% is recommended)

    • Aliquot for long-term storage at -20°C/-80°C

Repeated freeze-thaw cycles should be strictly avoided as they can significantly compromise protein integrity. The protein is supplied in Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain stability during storage .

What experimental systems are suitable for studying Pnap_4944 function?

Several experimental systems can be employed to study Pnap_4944, depending on your research objectives:

  • Nanodiscs systems: Nanodiscs provide a native-like membrane environment for studying membrane proteins like Pnap_4944. The styrene-maleic acid (SMA) copolymer approach allows extraction of membrane proteins directly from native membranes while preserving the surrounding lipid environment. SMA(3:1) copolymer has been successfully used for purifying membrane proteins with yields of up to 255 μg/L in some cases .

  • Fluorescence-based assays: Introducing fluorescent reporters (e.g., IAEDANS) to specific cysteine residues and monitoring changes in fluorescence signals upon ligand binding can provide insights into protein conformational changes and interactions .

  • NMR spectroscopy: For detailed structural analysis, 19F NMR spectroscopy can be employed by labeling tryptophan residues with fluorine-19. Due to the rapid tumbling of ~8 nm diameter nanodiscs, the 19F signals are generally resolvable by solution-state NMR, with transmembrane domain signals becoming better resolved at higher temperatures (e.g., 48°C) .

  • Biophysical characterization: Techniques such as dynamic light scattering (DLS) can be used to monitor the size and homogeneity of protein-containing nanodiscs under different conditions .

How can I optimize the expression and purification of Pnap_4944?

Optimizing membrane protein expression requires careful consideration of growth conditions and harvest timing:

  • Growth conditions:

    • Contrary to common assumptions, the most rapid growth conditions are not optimal for membrane protein production

    • Use high-performance bioreactors under tightly-defined growth regimes

    • Ensure precise control of temperature, pH, and nutrient availability

  • Harvest timing:

    • Critical factor: harvest cells prior to glucose exhaustion, just before the diauxic shift

    • Harvesting at this specific phase can significantly improve protein yields without corresponding changes in mRNA levels

  • Expression system considerations:

    • E. coli is the standard expression system for Pnap_4944

    • For more complex membrane proteins, yeast systems can be considered

    • Gene expression optimization should focus on the differential expression of genes involved in membrane protein secretion and cellular physiology

Growth PhaseRelative Protein YieldKey Physiological State
Early log phaseLowCellular machinery not fully engaged
Mid-log phaseModerateBalanced growth conditions
Pre-diauxic shiftOptimalMaximum membrane protein production capacity
Post-diauxic shiftDecreasedStress responses may degrade target protein
Stationary phaseVery lowDecreased translation, increased proteolysis

This table represents general trends observed in membrane protein expression studies and can guide harvest timing optimization .

What structural analysis approaches are recommended for Pnap_4944?

For structural analysis of Pnap_4944, consider these methodological approaches:

  • Cryo-electron microscopy (cryo-EM):

    • Particularly suitable for membrane proteins

    • Can be combined with in vitro reconstitution and biochemical assays

    • Allows visualization of protein in different conformational states

    • No crystallization required, which is advantageous for membrane proteins

  • Computational modeling and design:

    • Deep learning pipelines can be employed to design complex folds and soluble analogues

    • This approach has shown remarkable design accuracy for membrane proteins

    • Can be used to create soluble analogues with high thermal stability

    • Enables functionalization with native structural motifs for potential drug discovery applications

  • Hybrid approach for comprehensive characterization:

    • Combine experimental structural data with computational predictions

    • Validate computational models with limited experimental data

    • Use molecular dynamics simulations to explore conformational flexibility

    • Integrate structural information with functional assays to establish structure-function relationships

How do I address challenges in membrane protein stability during experimental procedures?

Membrane proteins, including Pnap_4944, present unique stability challenges that require specific methodological solutions:

  • Buffer optimization strategy:

    • Systematic screening of buffer components (pH, salt concentration, additives)

    • Inclusion of specific lipids that may be required for stability

    • Addition of stabilizing agents like glycerol or trehalose

    • Consider cholesterol or other sterols for additional stability

  • Temperature considerations:

    • Many membrane proteins benefit from purification at 4°C to preserve the native state

    • Specific thermal stability assays can identify optimal working temperatures

    • Some membrane proteins exhibit improved stability at higher temperatures due to increased conformational flexibility

  • Detergent selection and concentration:

    • Critical for extraction while maintaining native structure

    • Gradual detergent removal techniques for reconstitution into membranes

    • Consider detergent-free approaches like SMA copolymers for native nanodisc formation

    • Optimization of detergent:protein:lipid ratios is essential

What are the cutting-edge approaches for studying Pnap_4944 interactions with other proteins and lipids?

Advanced methodologies for studying Pnap_4944 interactions include:

  • MS/MS analysis of SMALPs (Styrene Maleic Acid Lipid Particles):

    • Enables identification of specifically associated phospholipids from plasma membranes

    • Provides insights into the native lipid environment of the membrane protein

    • Can reveal preferential lipid associations that may be functionally relevant

  • Chemical shift perturbation studies:

    • NMR-based approach to detect protein-lipid interactions

    • Can identify specific binding sites for phospholipids like phosphatidylserine

    • Observe line broadening effects upon addition of interacting proteins

    • Provides atomic-level details of interaction interfaces

  • Multivalent binding analysis:

    • Deciphering complex protein-membrane interactions through individual component analysis

    • Investigating roles of specific domains in membrane recognition

    • Understanding autoinhibitory mechanisms that regulate binding

    • Characterizing the effects of post-translational modifications on binding properties

How can computational approaches advance our understanding of Pnap_4944?

Computational methodologies offer powerful approaches to expand our understanding of Pnap_4944:

  • Deep learning for structure prediction and design:

    • Recent advances enable de novo design of complex protein folds

    • Can create soluble analogues of integral membrane proteins

    • High experimental success rates in recapitulating structural features

    • Potential to expand the functional soluble fold space

  • Molecular dynamics simulations:

    • Model protein behavior in different membrane environments

    • Investigate conformational changes and dynamics

    • Study effects of mutations on protein stability and function

    • Explore protein-lipid interactions at atomic resolution

  • Integration with experimental data:

    • Validation of computational models with limited experimental data

    • Refinement of structural models based on low-resolution experimental constraints

    • Prediction of functional sites for targeted experimental validation

    • Design of optimized constructs for improved expression and stability

What are the implications of Pnap_4944 research for membrane protein biology?

Research on Pnap_4944 contributes to broader advances in membrane protein biology:

  • Expanding membrane protein structural diversity:

    • Each new membrane protein structure contributes to our understanding of fold space

    • Identification of novel structural motifs and their functional implications

    • Improved classification systems for membrane protein families

    • Better understanding of evolutionary relationships between membrane proteins

  • Advancing membrane protein production technologies:

    • Optimization approaches for Pnap_4944 can be applied to other challenging membrane proteins

    • Development of systematic, rather than trial-and-error approaches

    • Identification of critical factors affecting membrane protein yields

    • Understanding the relationship between cellular physiology and protein production

  • Bridging the gap between membrane and soluble proteins:

    • Creation of soluble analogues with membrane protein structural features

    • Expanding functional properties available in the soluble proteome

    • Enabling new approaches in drug discovery by making membrane protein targets more accessible

    • Development of novel biotechnology applications through protein engineering

How do I address low yields in Pnap_4944 expression?

When facing low expression yields of Pnap_4944, consider these methodological interventions:

  • Optimize growth and induction conditions:

    • Vary temperature, inducer concentration, and induction time

    • Use tightly-controlled bioreactor conditions rather than shake flasks

    • Harvest cells at the optimal growth phase, just before the diauxic shift

    • Consider slower growth rates which may favor proper membrane protein folding

  • Genetic optimization approaches:

    • Codon optimization for the expression host

    • Co-expression with molecular chaperones

    • Use of specialized expression strains designed for membrane proteins

    • Consider fusion partners that may enhance membrane insertion and stability

  • Expression host considerations:

    • E. coli remains the primary host for Pnap_4944 expression

    • Alternative hosts like Pichia pastoris may be considered for difficult-to-express constructs

    • Differences in membrane composition between hosts can affect protein folding and stability

    • Membrane protein yields are influenced by the differential expression of genes involved in secretion and cellular physiology

What strategies can overcome protein aggregation during Pnap_4944 purification?

Protein aggregation is a common challenge with membrane proteins like Pnap_4944. Address this methodologically:

  • Buffer and detergent optimization:

    • Systematic screening of detergent types and concentrations

    • Addition of lipids to stabilize native conformation

    • Inclusion of glycerol or other stabilizing agents

    • Maintenance of consistent cold-chain throughout purification

  • Alternative solubilization approaches:

    • Consider SMA copolymers for native nanodisc formation

    • SMA(3:1) copolymer has been successfully used for membrane protein purification

    • This approach preserves the native lipid environment around the protein

    • The polymer inserts into bilayers until saturation before solubilization

  • Size-based approaches:

    • Monitor aggregation state using dynamic light scattering

    • Apply size exclusion chromatography to remove aggregates

    • Optimize protein concentration to minimize aggregation

    • Consider the relationship between nanodisc size and protein stability

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.