Recombinant Polaromonas sp. Disulfide bond formation protein B (dsbB)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Polaromonas sp. Disulfide Bond Formation Protein B (DsbB)

Recombinant Polaromonas sp. DsbB is a synthetic version of the bacterial protein DsbB, engineered for research and biotechnological applications. DsbB is a membrane-bound disulfide oxidoreductase critical for catalyzing disulfide bond formation in periplasmic proteins, a process essential for protein stability and function in Gram-negative bacteria. The recombinant form is produced via in vitro expression systems, typically in E. coli, and is optimized for structural or functional studies of disulfide bond pathways.

Functional Role

DsbB oxidizes DsbA (a periplasmic dithiol oxidase), enabling DsbA to catalyze disulfide bond formation in substrate proteins. This process involves:

  1. Electron transfer: Reduced DsbA donates electrons to DsbB’s periplasmic cysteines.

  2. Quinone oxidation: DsbB transfers electrons to quinones in the membrane .

Expression Systems

Recombinant DsbB is produced using E. coli or yeast systems with N-terminal His-tags for purification:

ParameterFull-Length DsbB (CSB-CF615550PAAI)Partial DsbB (CSB-YP615550PAAI1)
SourceE. coliYeast
Sequence LengthFull-length (1–168 residues)Partial (truncated)
Purity>85% (SDS-PAGE)>85% (SDS-PAGE)
Tagging10xHis-tagUndisclosed tag
Storage-20°C/-80°C (liquid/lyophilized)-20°C/-80°C (liquid/lyophilized)

Data compiled from product specifications .

Purification Methods

  • Immobilized Metal Affinity Chromatography (IMAC): His-tagged proteins bind to nickel/cobalt columns.

  • Size-Exclusion Chromatography (SEC): Used for further purification and buffer exchange .

Functional Studies

  • Disulfide bond formation assays: Used to test substrate specificity or inhibitor efficacy.

  • Antimicrobial development: DsbB is a target for inhibitors disrupting bacterial protein folding .

Challenges and Limitations

  1. Activity in vitro: Recombinant DsbB requires quinones and DsbA for functional assays, complicating experimental setups.

  2. Limited Polaromonas-specific data: Most studies focus on E. coli DsbB, leaving gaps in understanding Polaromonas homologs.

  3. Membrane protein instability: Transmembrane domains make purification and handling challenging .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate it in your order remarks. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery estimates, please consult your local distributor.
Note: All protein shipments are accompanied by standard blue ice packs. If you require dry ice, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage, working aliquots can be stored at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1 and 1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquotting the solution. Store aliquots at -20°C or -80°C. Our standard glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life is influenced by various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, liquid forms have a shelf life of 6 months when stored at -20°C or -80°C. Lyophilized forms have a shelf life of 12 months when stored at -20°C or -80°C.
Storage Condition
Upon receipt, store at -20°C or -80°C. Aliquot the protein for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
dsbB; Bpro_2385; Disulfide bond formation protein B; Disulfide oxidoreductase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-168
Protein Length
full length protein
Species
Polaromonas sp. (strain JS666 / ATCC BAA-500)
Target Names
dsbB
Target Protein Sequence
MFLTYFDAMPRRVLALVSLACVALLAFGLYLQHVVGLEPCPMCIVQRYALVLVAVVAGIT AVAKSRGLLITGSGLLVLLSGFGAFVAARQSFLQWYPPEVASCGRDFYGMIETFPLKRAI PMIFKGSGDCTKIDWTFLGLSIANWSFLCFVAIALVGLVLITRLARQR
Uniprot No.

Target Background

Function
Essential for disulfide bond formation in certain periplasmic proteins. Functions by oxidizing the DsbA protein.
Database Links
Protein Families
DsbB family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Polaromonas sp. and why is it significant for DsbB research?

Polaromonas species are psychrotolerant bacteria belonging to the class Betaproteobacteria and represent important components of glacial microbiomes in Arctic and Antarctic environments . These cold-active bacteria have evolved specialized molecular mechanisms to function in extreme conditions, making their protein systems particularly valuable for biotechnological applications. The DsbB protein from Polaromonas is significant because it provides insights into how disulfide bond formation machinery operates in cold-adapted organisms. Unlike mesophilic counterparts, Polaromonas sp. DsbB may contain structural adaptations that enable efficient catalytic activity at low temperatures while maintaining sufficient flexibility .

What genomic features characterize the dsbB gene in Polaromonas strains?

The dsbB gene in Polaromonas strains is likely part of the core genome, though it may also appear on extrachromosomal elements in some isolates. Based on analysis of Polaromonas plasmidomes, many functional genes in these bacteria have undergone horizontal transfer, potentially including redox-active proteins. The genomic context of dsbB in Polaromonas often includes genes involved in stress response and adaptation to environmental conditions, particularly those related to oxidative stress protection mechanisms that are critical in cold, high-UV environments like polar glaciers .

What approaches are recommended for solubilizing recombinant Polaromonas sp. DsbB?

When working with recombinant Polaromonas sp. DsbB, researchers should consider advanced solubilization techniques such as the SIMPLEx (Solubilization of Integral Membrane Proteins with high Levels of Expression) method. This approach involves creating chimeric constructs where the DsbB protein is genetically fused at its C-terminus to a truncated apolipoprotein (ApoAI*) and at its N-terminus to a highly soluble "decoy" protein such as maltose-binding protein (MBP) .

For optimal results, consider the following methodological steps:

  • Remove the flexible C-terminal segment (approximately the last 13 amino acids) of DsbB that may interfere with the interaction between DsbB and ApoAI*

  • Enhance helix-helix interactions by introducing glycine zipper motifs (GxxxG) in the transmembrane domains

  • Express the constructs in E. coli strains optimized for membrane protein expression (e.g., C41/C43 or Lemo21)

  • Purify using affinity chromatography under non-denaturing conditions without detergents

This approach has successfully converted membrane-bound DsbB variants into water-soluble biocatalysts that retain their functional activity in aqueous solutions .

How should researchers design controls for functional assays of recombinant Polaromonas sp. DsbB?

Robust experimental design for functional assays of recombinant Polaromonas sp. DsbB requires carefully constructed controls to ensure reliable and valid results . The following control strategy is recommended:

Control TypeDescriptionPurpose
Negative ControlDsbB variant with mutated catalytic cysteinesEstablishes baseline when no enzymatic activity is present
Positive ControlWell-characterized E. coli DsbBProvides comparison to standard DsbB activity
Temperature ControlsParallel assays at different temperatures (4°C, 15°C, 25°C, 37°C)Determines temperature optima and adaptation characteristics
Substrate ControlsVarying concentrations of DsbA or model substratesEstablishes kinetic parameters and substrate specificity
System ControlComplementation of E. coli dsbB knockout strainConfirms in vivo functionality

Additionally, researchers should implement procedural controls to account for spontaneous oxidation, particularly when using colorimetric assays that detect disulfide bond formation. Include buffer-only controls and heat-inactivated enzyme preparations to distinguish enzymatic activity from background reactions .

What expression systems are optimal for producing functional Polaromonas sp. DsbB?

When selecting an expression system for Polaromonas sp. DsbB, researchers must consider multiple factors including protein folding, membrane insertion, and low-temperature functionality. For membrane-bound native DsbB, a dual-approach strategy is recommended:

  • Cold-adapted expression host approach:

    • Use Polaromonas sp. itself or related psychrophilic bacteria as expression hosts

    • Utilize native promoters and ribosome binding sites for physiologically relevant expression levels

    • Culture at 4-15°C to ensure proper folding of cold-adapted protein machinery

  • Engineered E. coli approach:

    • Employ specialized E. coli strains designed for membrane protein expression (C41/C43)

    • Use tunable expression systems like PBAD or Tet-inducible promoters

    • Lower induction temperature to 16-20°C during expression phase

    • Supplement media with specific lipids that mimic Polaromonas membrane composition

For water-soluble DsbB variants, the SIMPLEx technique with E. coli as an expression host has proven effective, allowing cytoplasmic expression of DsbB chimeras that retain catalytic activity while remaining soluble without detergents .

How can researchers address the structural characterization of Polaromonas sp. DsbB?

Structural characterization of Polaromonas sp. DsbB presents significant challenges due to its membrane-embedded nature and potential instability when removed from its native lipid environment. A multi-technique approach is recommended:

  • Cryo-electron microscopy: For native-state structure determination, prepare samples using nanodiscs or amphipols to maintain the membrane protein in a near-native environment. Focus on single-particle analysis with high-resolution detectors.

  • X-ray crystallography of soluble variants: Utilize the water-soluble DsbB variants created through the SIMPLEx technique, focusing on crystallization trials at lower temperatures (4-15°C) to maintain the protein in its most relevant conformational state .

  • NMR spectroscopy: For dynamics studies, prepare isotopically labeled protein (15N, 13C) and employ solution NMR techniques optimized for membrane proteins, such as transverse relaxation-optimized spectroscopy (TROSY).

  • Molecular dynamics simulations: Complement experimental approaches with computational modeling that incorporates parameters mimicking cold conditions, particularly focusing on the flexibility of transmembrane domains containing GxxxG motifs and the conformational changes during the catalytic cycle .

The structural data should be correlated with functional assays to establish structure-function relationships specific to the cold-adapted nature of Polaromonas sp. DsbB.

What methodologies can resolve apparent contradictions in DsbB activity data across temperature ranges?

Researchers often encounter apparently contradictory results when studying Polaromonas sp. DsbB activity across different temperature ranges. These contradictions may arise from temperature-dependent conformational changes, altered substrate binding kinetics, or shifts in reaction mechanisms. To resolve these contradictions, implement the following methodological approach:

  • Temperature-resolved enzyme kinetics: Perform detailed Michaelis-Menten kinetics at 5°C increments from 0°C to 40°C, determining kcat and KM values at each temperature point.

  • Thermodynamic analysis: Calculate activation energies (Ea) using Arrhenius plots and determine entropy and enthalpy contributions through temperature-dependent studies.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Apply this technique at various temperatures to identify regions of the protein that exhibit differential flexibility or accessibility.

  • Multivariable experimental design: Implement factorial design experiments that simultaneously vary temperature, pH, ionic strength, and substrate concentration to identify interaction effects between these variables.

  • Statistical analysis of apparent contradictions: Apply mixed-effects models to analyze data sets that contain seemingly contradictory results, partitioning variance components to identify sources of variability.

This comprehensive approach allows researchers to determine whether contradictions reflect true biological phenomena (such as temperature-dependent mechanistic shifts) or methodological artifacts.

How should researchers approach the adaptation of DsbB assays from mesophilic to psychrophilic systems?

When adapting standard DsbB assays developed for mesophilic systems (e.g., E. coli) to psychrophilic Polaromonas sp. DsbB, researchers must systematically modify protocols to account for temperature-dependent effects. The following methodological workflow is recommended:

  • Buffer optimization:

    • Test multiple buffer systems for stability at low temperatures

    • Adjust ionic strength to compensate for temperature effects on electrostatic interactions

    • Include cryoprotectants if necessary for protein stability below 4°C

  • Kinetic parameter adjustment:

    • Extend reaction monitoring times to account for potentially slower reaction rates

    • Increase sensitivity of detection methods to capture lower activity levels

    • Establish temperature correction factors for comparative studies

  • Equipment calibration:

    • Verify temperature control accuracy in spectrophotometers and plate readers

    • Ensure uniform temperature distribution in reaction vessels

    • Implement pre-equilibration steps for all components

  • Data interpretation framework:

    • Develop normalization methods that account for temperature effects on assay components

    • Establish relative activity metrics that enable meaningful comparison between temperature points

    • Create temperature-activity profiles specific to Polaromonas sp. DsbB

This systematic approach ensures that assay results reflect true biological characteristics rather than methodological artifacts when working with psychrophilic enzyme systems.

What statistical approaches are most appropriate for analyzing temperature-dependent activity of Polaromonas sp. DsbB?

When analyzing temperature-dependent activity data for Polaromonas sp. DsbB, researchers should implement a comprehensive statistical framework that accounts for the complex relationship between temperature, enzyme kinetics, and experimental variability. The following statistical approaches are recommended:

  • Non-linear regression modeling:

    • Apply modified Arrhenius equations that incorporate temperature optima parameters

    • Use segmented regression to identify transition temperatures where mechanisms may change

    • Implement enzyme kinetic models that include temperature-dependent parameters

  • Multivariate analysis:

    • Employ principal component analysis (PCA) to identify patterns in multiparameter data sets

    • Use partial least squares (PLS) regression when analyzing multiple dependent variables

    • Apply hierarchical clustering to identify temperature ranges with similar kinetic behaviors

  • Experimental design considerations:

    • Utilize response surface methodology to optimize multiple parameters simultaneously

    • Implement blocked experimental designs to control for batch effects

    • Use power analysis to determine appropriate sample sizes for detecting temperature effects

  • Validation approaches:

    • Apply cross-validation techniques to assess model robustness

    • Conduct bootstrap resampling to generate confidence intervals for kinetic parameters

    • Implement Bayesian statistical approaches for incorporating prior knowledge

How can researchers integrate structural and functional data to understand cold adaptation in Polaromonas sp. DsbB?

To develop a comprehensive understanding of cold adaptation in Polaromonas sp. DsbB, researchers must systematically integrate structural and functional data. The following methodological approach facilitates this integration:

  • Structure-function correlation analysis:

    • Map activity measurements to specific structural elements

    • Identify flexible regions that may contribute to cold adaptation through comparative analysis with mesophilic homologs

    • Correlate the presence of specific amino acid substitutions with functional parameters at different temperatures

  • Molecular dynamics-guided interpretation:

    • Conduct simulations at various temperatures (0°C, 15°C, 30°C) to identify dynamic differences

    • Calculate root-mean-square fluctuations (RMSF) of protein regions to identify temperature-sensitive elements

    • Analyze hydrogen bonding networks and hydrophobic interactions as a function of temperature

  • Mutational analysis strategy:

    • Design site-directed mutations targeting regions with temperature-dependent flexibility

    • Introduce or remove GxxxG motifs to assess their contribution to membrane protein stability at low temperatures

    • Create chimeric proteins combining domains from psychrophilic and mesophilic DsbB variants

  • Data integration framework:

    • Develop mathematical models incorporating both structural parameters and kinetic data

    • Apply machine learning approaches to identify patterns in complex multiparameter datasets

    • Create visual representations that simultaneously display structural features and functional metrics

This integrated approach enables researchers to move beyond correlative observations toward mechanistic understanding of how specific structural adaptations in Polaromonas sp. DsbB enable its function in cold environments.

What considerations are important when comparing plasmid-encoded versus chromosomal dsbB genes in Polaromonas species?

When investigating dsbB genes in Polaromonas species, researchers must carefully consider the genomic context, as some strains may carry dsbB on plasmids in addition to or instead of chromosomal copies. This comparative analysis requires special methodological considerations:

Plasmid-encoded genes in Polaromonas often contribute to environmental adaptation , so researchers should consider whether plasmid-borne dsbB might provide specialized functions beyond the canonical disulfide bond formation activity of chromosomal copies.

What methodological approaches would advance understanding of the ecological significance of Polaromonas sp. DsbB?

To investigate the ecological significance of DsbB in Polaromonas species within their natural glacial habitats, researchers should implement an integrated ecological and molecular approach:

This methodological framework would provide valuable insights into how DsbB contributes to the ecological success of Polaromonas species in extreme polar environments, potentially revealing novel applications in biotechnology and climate science.

How can computational methods enhance experimental approaches for studying Polaromonas sp. DsbB?

Computational methods offer powerful complements to experimental studies of Polaromonas sp. DsbB, particularly when addressing challenges related to membrane proteins and cold adaptation. The following integrated computational-experimental framework is recommended:

  • Structure prediction and analysis:

    • Apply AlphaFold2 or RoseTTAFold to generate high-confidence structural models

    • Conduct comparative modeling using multiple DsbB templates from diverse organisms

    • Analyze predicted structural features that may contribute to cold adaptation

  • Molecular dynamics simulation strategy:

    • Simulate DsbB behavior in membrane environments at various temperatures

    • Model water-soluble variants to predict structural stability without membrane support

    • Calculate energy landscapes to identify temperature-dependent conformational states

  • Machine learning applications:

    • Develop algorithms to predict optimal mutations for enhanced cold activity

    • Create models that integrate diverse experimental data types

    • Identify patterns in sequence-structure-function relationships across homologs

  • Experimental validation pipeline:

    • Design targeted experiments to test in silico predictions

    • Implement high-throughput screening based on computational insights

    • Develop automated feedback loops between computational predictions and experimental results

This integrated approach leverages computational power to guide experimental design while using experimental data to refine computational models, creating a synergistic research program that accelerates understanding of Polaromonas sp. DsbB's unique properties.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.