Recombinant Poly-beta-1,6-N-acetyl-D-glucosamine synthase (pgaC)

Shipped with Ice Packs
In Stock

Description

Functional Role in PGA Biosynthesis

PgaC synthesizes PGA through a c-di-GMP–dependent mechanism:

Enzymatic Mechanism

  • Substrate: UDP-N-acetylglucosamine (UDP-GlcNAc) .

  • Polymerization: Transfers GlcNAc monomers to form β-1,6-glycosidic linkages .

  • Regulation: Requires allosteric activation by cyclic di-GMP (c-di-GMP) via interaction with PgaD, its membrane partner .

Kinetic parameters:

  • KmK_m for UDP-GlcNAc: 270.5 ± 37.2 μM .

  • KactK_{act} for c-di-GMP: 62.2 ± 7.2 nM .

Synthase Complex Assembly

PgaC functions as part of a heterodimeric complex:

  • PgaD: Binds c-di-GMP and stabilizes PgaC’s transmembrane channel .

  • PgaAB: Outer membrane porin (PgaA) and deacetylase (PgaB) for polymer export and modification .

Recombinant Production and Applications

Recombinant PgaC is expressed in E. coli systems for functional studies:

Expression Systems

  • Vectors: pET28a-derived plasmids with N-terminal His tags .

  • Host strains: E. coli BL21 CodonPlus or DH5α .

Key Research Findings

StudyOutcome
Structural analysisPgaC’s GT domain shares homology with cellulose synthase BcsA .
c-di-GMP activationc-di-GMP increases VmaxV_{max} but not KmK_m, indicating allostery .
Biofilm disruptionEnzymatic hydrolysis of PGA by dispersin B (DspB) eliminates biofilms .

Catalytic Domain Architecture

  • The GT domain contains a conserved "TED" motif for acceptor deprotonation .

  • Transmembrane helices 3 and 6 form a secretion-competent pore .

Mutational Studies

  • PgaC R222A: Abolishes c-di-GMP binding and PGA synthesis .

  • PgaD NKLR motif: Critical for c-di-GMP–dependent complex activation .

Applications in Biofilm Research

Recombinant PgaC is pivotal for:

  1. Biofilm inhibition: Targeting PGA synthesis with enzymatic or chemical inhibitors .

  2. Therapeutic development: Engineering enzymes like DspB to degrade pathogenic biofilms .

Challenges and Future Directions

  • Structural resolution: Full-length PgaC structure remains uncharacterized .

  • Dynamic regulation: Role of c-di-GMP flux in modulating PgaCD activity in vivo .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, serving as a guideline for your preparations.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its inclusion.
Synonyms
pgaC; Z1524; ECs1268; Poly-beta-1,6-N-acetyl-D-glucosamine synthase; PGA synthase; Poly-beta-1,6-GlcNAc synthase; Biofilm PGA synthesis protein PgaC; N-acetylglucosaminyltransferase PgaC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-441
Protein Length
full length protein
Species
Escherichia coli O157:H7
Target Names
pgaC
Target Protein Sequence
MINRIVSFFILCLVLCIPLCVAYFHSGELMMRFVFFWPFFMSIMWIVGGVYFWVYRERRW PWGENAPAPQLKDNPSISIIIPCFNEEKNVEETIHAALAQRYENIEVIAVNDGSTDKTRA ILDRMAAQIPHLRVIHLAQNQGKAIALKTGAAAAKSEYLVCIDGDALLDRDAAAYIVEPM LYNPRVGAVTGNPRIRTRSTLVGKIQVGEYSSIIGLIKRTQRIYGNVFTVSGVIAAFRRS ALAEVGYWSDDMITEDIDISWKLQLNQWTIFYEPRALCWILMPETLKGLWKQRLRWAQGG AEVFLKNMTRLWRKENFRMWPLFFEYSLTTIWAFTCLVGFIIYAVQLAGVPLNIELTHIA ATHTAGILLCTLCLLQFIVSLMIENRYEHNLTSSLFWIIWFPVIFWMLSLATTLVSFTRV MLMPKKQRARWVSPDRGILRG
Uniprot No.

Target Background

Function

Recombinant Poly-beta-1,6-N-acetyl-D-glucosamine synthase (pgaC) is a probable N-acetylglucosaminyltransferase. It catalyzes the polymerization of UDP-N-acetylglucosamine monomer units to produce poly-beta-1,6-N-acetyl-D-glucosamine (PGA), a linear homopolymer and biofilm adhesin polysaccharide.

Database Links

KEGG: ece:Z1524

STRING: 155864.Z1524

Protein Families
Glycosyltransferase 2 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Poly-beta-1,6-N-acetyl-D-glucosamine synthase (pgaC) and how does it function in bacteria?

Poly-beta-1,6-N-acetyl-D-glucosamine synthase (pgaC) is a probable N-acetylglucosaminyltransferase that catalyzes the polymerization of single monomer units of UDP-N-acetylglucosamine to produce the linear homopolymer poly-beta-1,6-N-acetyl-D-glucosamine (PGA), a biofilm adhesin polysaccharide . PgaC is a multi-pass membrane protein located in the bacterial inner membrane, containing 4 predicted transmembrane domains plus 2 membrane-associated domains, with both N and C-termini predicted to be in the cytoplasm .

Functionally, pgaC operates as part of a complex with pgaD, forming the PgaCD complex which polymerizes PGA and transports it across the inner membrane for further processing by PgaB and PgaA . Research has demonstrated that disruption of the pgaC gene prevents bacterial cells from synthesizing PGA, resulting in reduced biofilm formation .

What is the structure and organization of the pgaABCD operon?

The pgaABCD operon encodes four proteins essential for the synthesis and export of poly-β-1,6-N-acetyl-D-glucosamine (PNAG/PGA). The organization of this operon is conserved across multiple bacterial species:

  • pgaA: Encodes an outer membrane protein involved in the export of deacetylated PNAG

  • pgaB: Encodes a protein with deacetylase activity that partially removes acetyl groups from PNAG

  • pgaC: Encodes the glycosyltransferase that polymerizes UDP-N-acetylglucosamine into PNAG

  • pgaD: Encodes a small protein that forms a complex with PgaC

In Escherichia coli, the expression of the pgaABCD operon is regulated by temperature and growth phase, with higher expression observed at 37°C compared to 21°C, and maximal expression during stationary phase . This operon is highly conserved, with homologous systems identified in multiple bacterial genera including Staphylococcus (icaABCD), Acinetobacter, Burkholderia, Klebsiella, and Yersinia .

What techniques can be used to detect and quantify PNAG production in bacterial systems?

Multiple analytical techniques have been established for detecting and quantifying PNAG production in bacterial systems:

  • Immunoblot assays: Using antibodies specific to PNAG to detect its presence in bacterial samples. This method has been used to screen clinical isolates for PNAG production .

  • Thin-layer chromatography (TLC): Useful for detecting low-molecular-weight oligosaccharides resulting from PNAG digestion by specific enzymes like DspB .

  • Mass spectrometry: Provides detailed structural analysis of PNAG and its degradation products. Matrix-assisted laser desorption/ionization time-of-flight (MALDI-TOF) mass spectrometry has been used to characterize PNAG oligomers up to GlcNAc28 .

  • Nuclear magnetic resonance (NMR): Can confirm the identity of PNAG and determine the degree of acetylation. NMR analysis of polysaccharide material from Acinetobacter baumannii confirmed it was PNAG with approximately 60% of the glucosamine amino groups acetylated .

  • Confocal laser scanning microscopy: Combined with COMSTAT analysis to visualize and quantify biofilm parameters such as biovolume, mean thickness, and maximum thickness in wild-type versus pgaC mutant strains .

How does the PgaC-PgaD complex function in PNAG synthesis and what factors regulate this interaction?

The PgaC-PgaD complex functions as a β-glycosyltransferase that polymerizes poly-N-acetyl glucosamine (PGA) from UDP-N-acetyl-D-glucosamine (UDP-GlcNAc) precursors and transports it across the inner membrane for further processing . This complex demonstrates sophisticated regulation mechanisms:

  • Complex formation and stability: PgaC and PgaD form a stable complex that is essential for PNAG synthesis . The stability of this complex is a critical control point for regulating PNAG production.

  • Regulation by c-di-GMP: The second messenger cyclic di-3',5'-guanylate (c-di-GMP) acts as an allosteric activator of the PgaCD complex. It stimulates PgaC-PgaD interaction and increases complex stability . Experimental data shows:

    • c-di-GMP binds concurrently to the PgaC-PgaD complex but not to individual components

    • The binding affinity increases in the presence of UDP-GlcNAc

    • c-di-GMP increases the enzyme's velocity approximately 20-fold in vitro without affecting substrate affinity

  • Subcellular localization: The complex is anchored in the inner membrane, with PgaC containing 4 transmembrane domains and 2 membrane-associated domains, while PgaD contains 2 transmembrane domains .

  • Catalytic domains: PgaC contains 2 predicted catalytic domains positioned in the cytoplasm, where they can access the UDP-GlcNAc substrate .

  • Expression regulation: The expression of pgaC and pgaD is regulated by growth conditions, with higher expression at 37°C than at 21°C and maximal expression during stationary phase .

The absence of either PgaC or PgaD results in reduced biofilm formation and lack of PGA accumulation, demonstrating their interdependent functions in PNAG synthesis .

What methodological approaches can be used to improve recombinant pgaC expression and activity?

Several methodological approaches have shown promise for improving recombinant protein expression and activity, which can be applied to pgaC:

  • Promoter selection: Implementing physiologically-regulated promoters. For example, improved enzyme activity was observed when a promoter regulated under σ* was used for recombinant enzyme expression .

  • Osmotic shock treatment: Applying osmotic shock as a global stress response can improve protein folding and activity. High concentrations of sucrose in conjunction with physiologically-regulated promoters like proU significantly increased recombinant enzyme production and activity .

  • Chaperone co-expression: While the overexpression of native chaperones did not improve activity in some recombinant enzyme systems, this approach may be worth exploring for pgaC expression .

  • Disulfide bond formation enhancement: Techniques to enhance cytoplasmic disulfide bond formation can improve the folding and activity of recombinant proteins .

  • Expression systems optimization: In studies with recombinant human N-acetylgalactosamine-6-sulfatase (rhGALNS), researchers found that strategies to increase soluble protein concentration and improve protein folding led to enhanced enzyme activity .

For pgaC specifically, expression in Escherichia coli has been successfully used for heterologous expression of the A. baumannii pga locus, leading to significant amounts of PNAG production . When designing expression systems for recombinant pgaC, consider that PgaC functions in a complex with PgaD, so co-expression may be necessary for optimal activity.

How does phosphorylation affect PgaB function and PNAG production in bacterial systems?

Phosphorylation plays a critical regulatory role in PgaB function and subsequent PNAG production:

  • Identification of phosphorylation sites: Research on Acinetobacter baumannii PgaB (AbPgaB1) identified specific phosphorylation sites, notably Ser411, which is phosphorylated in vivo .

  • Effect on catalytic activity: Phosphorylation of Ser411 modulates the product turnover rate of deacetylated PNAG, directly affecting biofilm production . Experimental evidence demonstrated that:

    • Phosphorylation impacts the binding and release of deacetylated PNAG (dPNAG)

    • Replacing Ser411 with Ala or Asp to mimic non-phosphorylated or phosphorylated conditions, respectively, alters enzyme kinetic parameters

    • These modifications significantly affect the deacetylation activity of AbPgaB1

  • Structural basis: Modeling studies revealed that phosphorylation sites, including Ser411 and Asp413, are positioned close to the substrate binding site. The p-peptide "407TDPVSKDLVVTEQAK421" in loop 11 contains multiple phosphorylation sites (T407, D408, S411, and D413) that may regulate AbPgaB1 activity .

  • Conserved structural elements: Analysis of PgaB from different bacterial species showed highly conserved GlcNAc tetrasaccharide interacting residues. For example, residue W549 and D470 from AbPgaB1 are spatially conserved compared to W552 and D472 in E. coli PgaB, suggesting common substrate binding mechanisms .

This phosphoryl-regulation mechanism provides bacteria with a sophisticated way to control PNAG production and biofilm formation in response to environmental conditions.

What is the role of PNAG in bacterial biofilm formation and pathogenesis?

PNAG plays multifaceted roles in bacterial biofilm formation and pathogenesis:

  • Biofilm adhesin function: PNAG serves as a critical adhesin in biofilm formation for multiple bacterial species including Escherichia coli, Staphylococcus epidermidis, Yersinia pestis, and Pseudomonas fluorescens . Enzymatic hydrolysis of poly-β-1,6-GlcNAc has been shown to disrupt biofilm formation in these species .

  • Biofilm structure: In Acinetobacter baumannii, deletion of the pga locus results in significant reduction in biofilm parameters including biovolume, mean thickness, and maximum thickness at both 16-hour and 48-hour timepoints, which can be restored by complementation .

  • Cell surface association: During severe Klebsiella pneumoniae pulmonary infection, PNAG production undergoes a switch from extracellular networks to a cell-associated phenotype coating the bacterial cell surface . This dynamic regulation suggests a role in adaptation to different infection environments.

  • Interaction with other surface components: In Klebsiella pneumoniae, the capsular polysaccharide is a key determinant of PNAG localization. Deleting genes involved in capsule synthesis (ΔwcaJ) or regulation (ΔrmpADC) results in cell-associated PNAG during adherent growth and infection of alveolar epithelial cells in vitro .

  • Prevalence in clinical isolates: Studies of clinical isolates demonstrate widespread presence of the pgaABCD genes. For example, PCR analysis showed that all 30 clinical A. baumannii isolates examined had the pga genes, with varying levels of PNAG production .

  • Vaccine potential: Due to its conservation across diverse bacterial pathogens, PNAG is considered a promising broad-spectrum vaccine candidate . Vaccination with PNAG glycoconjugates has shown protection against lethal Staphylococcus aureus challenge in animal models .

  • Virulence contribution: PNAG production has been linked to bacterial virulence in various infection models. For example, deletion of pgaC from a hypervirulent Klebsiella pneumoniae strain resulted in reduced colonization of the gastrointestinal tract and reduced lethality following peritoneal challenge .

These findings highlight PNAG as not just a structural component of biofilms but also as a key virulence factor and potential therapeutic target in multiple bacterial pathogens.

What enzymatic approaches can be used to disrupt PNAG-dependent biofilms?

Enzymatic approaches offer promising strategies for disrupting PNAG-dependent biofilms:

  • DspB enzyme application: The enzyme dispersin B (DspB) has been demonstrated to specifically cleave the glycosidic linkages of poly-β-1,6-GlcNAc (PGA) . Research has shown that:

    • DspB endolytically hydrolyzes PGA, producing GlcNAc and low-molecular-weight oligosaccharides

    • This enzymatic treatment disrupts biofilm formation in multiple species including Escherichia coli, Staphylococcus epidermidis, Yersinia pestis, and Pseudomonas fluorescens

    • Treatment effectiveness can be verified through thin-layer chromatography (TLC) and mass spectrometry to detect degradation products

  • Specificity of enzymatic degradation: DspB shows specificity for β-1,6-GlcNAc polymers and does not degrade β-1,4-GlcNAc polymers like water-soluble chitin or glycol chitin . This specificity makes it a targeted approach for PNAG-dependent biofilms.

  • Degradation product analysis: Mass spectrometry analysis of DspB-treated PGA reveals a spectrum of oligosaccharide products ranging from GlcNAc2 to GlcNAc28, indicating the enzyme's ability to process the polymer through multiple cleavage events .

  • PgaB C-terminal domain activity: The C-terminal domain of PgaB from Bordetella bronchiseptica (BbPgaB) has been found to hydrolyze deacetylated PNAG (dPNAG) . This domain belongs to glycoside hydrolase family 153 (GH153) and requires a specific motif (GlcN-GlcNAc-GlcNAc) for cleavage .

  • Combination with antibiotics: Enzymatic disruption of PNAG-dependent biofilms could potentially enhance antibiotic efficacy by improving penetration into the biofilm structure, though this would require experimental validation for specific bacterial species and antibiotics.

These enzymatic approaches not only offer potential therapeutic strategies but also serve as valuable research tools for studying the role of PNAG in bacterial biofilm formation and pathogenesis.

How do variations in PNAG structure across different bacterial species impact biofilm properties?

PNAG structural variations across bacterial species significantly impact biofilm properties:

Understanding these structural variations is crucial for developing targeted anti-biofilm strategies and may explain differences in biofilm-related virulence across bacterial pathogens.

What are the current challenges in developing recombinant enzyme-based approaches for biofilm control?

Researchers face several significant challenges when developing recombinant enzyme-based approaches for biofilm control:

  • Enzyme stability and delivery: Maintaining enzyme stability in biofilm environments presents a significant challenge. Enzymes must remain active in the presence of varying pH conditions, proteases, and other inhibitory factors present in biofilms .

  • Penetration into biofilm structures: Ensuring that enzymes can penetrate dense biofilm matrices to reach their targets is challenging. The heterogeneous nature of biofilms creates diffusion barriers that may limit enzyme effectiveness, particularly in deeper biofilm layers.

  • Specificity versus broad-spectrum activity: While enzymes like DspB show specificity for β-1,6-GlcNAc polymers , many biofilms contain multiple polysaccharide types. Developing enzymes or enzyme cocktails with appropriate specificity profiles remains challenging.

  • Recombinant protein solubility: Production of soluble recombinant enzymes can be problematic. For example, research on recombinant human N-acetylgalactosamine-6-sulfatase (rhGALNS) faced challenges with protein aggregation, requiring optimization of expression conditions .

  • Expression system selection: Choosing appropriate expression systems is crucial. While E. coli is commonly used, it may not provide optimal conditions for all enzymes. Alternative systems include plant-based expression, as demonstrated for RTB-fused recombinant enzymes .

  • Post-translational modifications: Ensuring proper folding and post-translational modifications of recombinant enzymes remains challenging. Strategies such as osmotic shock treatment and physiologically-regulated promoters have shown promise in improving enzyme activity .

  • Resistance development: Bacteria may potentially adapt to enzymatic treatments through altered gene expression or selection of variants with modified PNAG structures, though this requires further research.

  • Integration with existing treatments: Determining how to effectively combine enzymatic approaches with conventional antibiotics or other treatments presents both challenges and opportunities for synergistic effects.

Addressing these challenges requires interdisciplinary approaches combining molecular biology, biochemistry, and biofilm research to develop effective recombinant enzyme-based strategies for biofilm control.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.