Recombinant Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD (icaD)

Shipped with Ice Packs
In Stock

Description

IcaD operates within the icaADBC operon to produce PNAG, a critical biofilm matrix component:

  • Enzymatic synergy: Co-expression with IcaA increases N-acetylglucosaminyltransferase activity by 40–50× compared to IcaA alone .

  • Genetic regulation: The icaD gene is upregulated during biofilm-associated infections, as shown in PCR studies of 68 S. epidermidis clinical isolates .

Key Findings from Staphylococcal Studies:

  • 94% of catheter-associated S. epidermidis strains harbored icaD, correlating with slime production .

  • Deletion of icaD abolishes PNAG synthesis, impairing bacterial aggregation and biofilm integrity .

Research Applications

Recombinant IcaD enables targeted investigations into bacterial pathogenicity and biofilm inhibition:

  • Antibody development: Used as an antigen to generate monoclonal antibodies targeting PNAG .

  • Enzyme kinetics: Assays measure glycosyltransferase activity under varying pH/temperature conditions .

  • Structural biology: Serves as a substrate for crystallography studies to identify IcaA-IcaD binding interfaces .

Comparative Analysis of IcaD Homologs

Functional conservation across bacterial species highlights IcaD’s evolutionary significance:

SpeciesGene LocusPNAG RoleClinical Relevance
S. epidermidisicaDCatheter biofilm formationNosocomial infections
S. aureus (MRSA252)SAR2748Immune evasionChronic osteomyelitis
A. actinomycetemcomitansmatBPellicle formation in oral biofilmsPeriodontitis

Technical Challenges and Solutions

  • Protein solubility: Refolding protocols using Tris-glycine buffers mitigate aggregation in E. coli-expressed IcaD .

  • Activity assays: Caspase-3 cleavage tests validate DNase-inhibitory function in hybrid ICAD-S/CAD complexes .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please consult your local distributor.
Please note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are settled at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products depends on various factors including storage conditions, buffer composition, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. The shelf life of lyophilized formulations is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us and we will prioritize developing the specified tag.
Synonyms
icaD; Poly-beta-1,6-N-acetyl-D-glucosamine synthesis protein IcaD; PGA synthesis protein IcaD; Poly-beta-1,6-GlcNAc synthesis protein IcaD; Biofilm polysaccharide intercellular adhesin synthesis protein IcaD; Biofilm PIA synthesis protein IcaD; Intercellular adhesion protein D
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-101
Protein Length
full length protein
Species
Staphylococcus epidermidis
Target Names
icaD
Target Protein Sequence
MVKPRQRQYPTVTSYLNIVRESLFITISGVFWMYCIVVMIVYIGTLINSQMESVITIRIA LNVENTEIYKLFGWMSLFVLIIFIFFTFSLAFQKYKKGRDI
Uniprot No.

Target Background

Function
IcaD is essential for the synthesis of poly-beta-1,6-N-acetyl-D-glucosamine (PNAG, also referred to as PIA), a biofilm adhesin polysaccharide. It is required for full IcaA N-acetylglucosaminyltransferase activity.
Protein Families
IcaD family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is the primary function of IcaD in bacterial cells?

IcaD is a small integral membrane protein that functions as part of the intercellular adhesion (ica) operon. Specifically, IcaD works in concert with IcaA as an N-acetylglucosaminyltransferase to synthesize poly-β-1,6-N-acetyl-D-glucosamine (PNAG) oligomers that are less than 20 residues in length . This transmembrane protein significantly increases PNAG biosynthesis when co-expressed with IcaA and is believed to aid in the translocation of PNAG across the bacterial cell membrane . The functional relationship between IcaD and IcaA is essential for initiating the production of PNAG, which serves as a critical component of biofilm formation in staphylococci and other bacterial species.

How does IcaD interact with other proteins in the ica operon?

IcaD is one of four proteins encoded by the ica operon (IcaA, IcaD, IcaB, and IcaC) that collectively synthesize PNAG. While IcaD partners with IcaA for oligomer synthesis, IcaC is a membrane protein believed to transport these IcaAD-synthesized oligomers across the cell membrane and participate in the formation of longer PNAG polymers . IcaB, which is found associated with the bacterial cell surface and in culture supernatants, functions as a deacetylase that removes acetyl groups from PNAG, resulting in a positively charged polymer . This deacetylation is crucial as it promotes the interaction between PNAG and the negatively charged bacterial cell surface. The coordinated action of these four proteins ensures proper synthesis, modification, and export of PNAG during biofilm formation.

What is the structural composition of IcaD?

IcaD is characterized as a small integral membrane protein . While the search results don't provide specific structural details about IcaD itself, comparative analysis with similar proteins suggests it contains transmembrane domains that anchor it within the bacterial cell membrane. Its association with IcaA, which contains multiple transmembrane domains and a large cytosolic family 2 glycosyltransferase domain, indicates that IcaD likely positions itself in a manner that facilitates the catalytic activity of the IcaA-IcaD N-acetylglucosaminyltransferase complex . The transmembrane nature of IcaD is critical for its function in PNAG synthesis and potentially in facilitating polymer translocation across the membrane.

What are the optimal expression systems for recombinant IcaD production?

When expressing recombinant IcaD, researchers should consider bacterial expression systems optimized for membrane proteins. E. coli-based systems with vectors containing strong inducible promoters (like T7 or tac) have been successfully employed for expressing components of the ica operon. Given IcaD's transmembrane nature, expression strategies should incorporate membrane-targeting sequences and careful induction protocols to prevent protein aggregation.

For functional studies, co-expression with IcaA is essential since IcaD significantly enhances PNAG biosynthesis when expressed alongside IcaA . Expression systems should ideally allow for controlled stoichiometry between IcaA and IcaD to mimic natural conditions. Temperature modulation (typically lowering to 18-25°C during induction) and inclusion of specific detergents during purification can improve correct folding and stability of transmembrane proteins like IcaD.

How can researchers effectively detect and quantify IcaD expression in bacterial samples?

Detection and quantification of IcaD expression can be accomplished through several complementary approaches:

  • Transcriptional Analysis: Quantitative PCR (qPCR) can measure icaD mRNA levels, providing insights into transcriptional regulation under various environmental conditions .

  • Immunoblotting: Western blot analysis using antibodies specific to IcaD can detect protein expression. Due to IcaD's small size and transmembrane nature, sample preparation should include appropriate membrane protein extraction protocols.

  • Fluorescent Protein Fusions: Creating IcaD-fluorescent protein fusions (with careful consideration of tag placement to avoid functional disruption) allows for visual confirmation of expression and localization.

  • Functional Assays: Since IcaD functions with IcaA as an N-acetylglucosaminyltransferase, enzymatic activity assays can indirectly confirm functional IcaD expression by measuring the synthesis of PNAG oligomers .

  • Mass Spectrometry: Proteomic approaches can identify and potentially quantify IcaD in complex protein mixtures, though membrane protein preparation requires specialized protocols.

What methods are most effective for studying IcaD's role in PNAG synthesis?

To study IcaD's specific contribution to PNAG synthesis, researchers should employ a multi-faceted approach:

  • Gene Deletion and Complementation: Creating icaD knockout mutants and complemented strains allows for comparative analysis of PNAG production. The Cas12a-assisted precise targeted cloning method (CAPTURE) described in search result offers an efficient approach for genetic manipulation of the ica operon.

  • Co-expression Studies: Expressing various combinations of ica genes (e.g., icaA alone versus icaA+icaD) helps elucidate IcaD's role in enhancing PNAG synthesis .

  • In vitro Reconstitution: Purifying IcaA and IcaD in appropriate membrane mimetics to reconstitute the N-acetylglucosaminyltransferase activity in vitro allows for detailed biochemical characterization.

  • Site-directed Mutagenesis: Creating targeted mutations in conserved residues of IcaD can identify regions critical for interaction with IcaA or for enzymatic function.

  • Crystal Structure Analysis: Though challenging with membrane proteins, structural studies of the IcaA-IcaD complex would provide valuable insights into the molecular mechanism of their coordinated function.

What environmental factors influence icaD expression in staphylococci?

The expression of icaD, as part of the icaADBC operon, is influenced by multiple environmental conditions. In staphylococci, several factors have been identified that affect icaADBC expression:

  • Temperature: High temperature can induce PIA/PNAG production and consequently icaD expression .

  • Oxygen Availability: Anaerobic conditions have been shown to upregulate the ica operon .

  • Osmolarity: High osmolarity environments can trigger increased expression of the ica genes .

  • Nutrient Availability: The presence of glucose significantly affects ica expression. In S. aureus, glucose upregulates PNAG production partly by alleviating IcaR-mediated repression of the icaADBC operon .

  • Chemical Agents: Subinhibitory concentrations of certain antibiotics including tetracycline, gentamicin, and streptogramins (quinopristin and dalfopristin) can increase PNAG production and ica expression .

  • Ethanol: Exposure to ethanol has been observed to induce PIA/PNAG production .

It's worth noting that strain-to-strain variation exists regarding which specific conditions most effectively induce PIA/PNAG production and icaD expression.

How is icaD transcription regulated at the molecular level?

Transcriptional regulation of icaD occurs primarily through control of the entire icaADBC operon. Several regulatory mechanisms have been identified:

  • IcaR Repression: IcaR functions as a repressor of ica transcription. Deletion of icaR in S. aureus has been shown to increase icaADBC expression by approximately 100-fold and PNAG production by 10-fold . Glucose appears to upregulate PNAG production in S. aureus at least partly by alleviating IcaR-mediated repression.

  • SarA Regulation: The staphylococcal accessory regulator A (SarA) positively regulates icaADBC expression in both S. aureus and S. epidermidis, though the regulatory mechanism differs between species.

  • Sigma Factor Dependencies: Alternative sigma factors may play roles in modulating ica expression under different environmental conditions.

  • Other Regulatory Proteins: Several other regulatory proteins have been implicated in controlling ica expression, creating a complex network of transcriptional control that allows bacteria to modulate biofilm formation in response to environmental cues.

Understanding these regulatory mechanisms provides potential targets for interventions aimed at controlling biofilm formation in clinical and industrial settings.

How does IcaD contribute to biofilm formation and bacterial virulence?

IcaD plays a crucial role in biofilm formation through its essential function in PNAG synthesis. The IcaA-IcaD complex initiates the production of PNAG oligomers, which are subsequently processed by IcaC and IcaB to form the mature, positively charged PNAG polymer that constitutes a major component of the biofilm matrix . This matrix enables bacteria to adhere to surfaces and to each other, forming complex three-dimensional structures that provide protection from antimicrobial agents and host immune responses.

The contribution of IcaD to virulence stems from this role in biofilm formation, which:

  • Enhances Colonization: PNAG-dependent biofilms facilitate bacterial adherence to host tissues and medical devices.

  • Increases Antibiotic Resistance: Biofilms provide a physical barrier that reduces antibiotic penetration and creates microenvironments where antibiotics are less effective.

  • Evades Host Immunity: The biofilm matrix shields bacteria from recognition and clearance by the host immune system.

  • Promotes Persistence: Bacteria within biofilms can enter dormant states that contribute to chronic, recalcitrant infections.

In staphylococci, particularly S. epidermidis and S. aureus, ica-dependent biofilm formation has been strongly linked to virulence in device-associated infections, endocarditis, and other invasive diseases. Targeting IcaD function represents a potential strategy for anti-biofilm therapeutics.

What methodologies are used to study the impact of IcaD mutations on biofilm formation?

Researchers employ several methodologies to investigate how IcaD mutations affect biofilm formation:

  • Site-Directed Mutagenesis: Creating specific mutations in conserved regions of icaD allows for structure-function analysis. The Cas12a-assisted precise targeted cloning (CAPTURE) method can facilitate this genetic manipulation .

  • Biofilm Quantification Assays:

    • Microtiter plate crystal violet assays measure biomass of attached biofilms

    • Confocal laser scanning microscopy provides three-dimensional visualization of biofilm architecture

    • Flow cell systems allow for dynamic biofilm formation studies under controlled conditions

  • PNAG Production Analysis:

    • Immunological detection using PNAG-specific antibodies

    • Chemical staining methods (e.g., Congo red binding)

    • Biochemical quantification of extracted polysaccharides

  • Transcriptional Analysis: Comparing expression of icaA, icaC, and icaB in wild-type versus icaD mutants reveals potential compensatory mechanisms or regulatory effects.

  • Animal Infection Models: Testing the virulence of icaD mutants in appropriate animal models provides insights into the importance of IcaD-dependent biofilm formation during infection.

These methodologies collectively enable researchers to establish causal relationships between specific IcaD functions and biofilm phenotypes, leading to a better understanding of how IcaD contributes to bacterial pathogenicity.

How can CRISPR-Cas systems be optimized for studying icaD function?

CRISPR-Cas systems offer powerful tools for studying icaD function with unprecedented precision. For optimal application in icaD research, consider the following specialized approaches:

  • Cas12a-Assisted Precise Targeted Cloning: The CAPTURE method described in search result provides an efficient approach for precise genetic manipulation. This method combines Cas12a digestion, T4 polymerase exo + fill-in DNA assembly, and Cre-lox in vivo DNA circularization, achieving nearly 100% efficiency for cloning large gene clusters .

  • Guide RNA Design Considerations:

    • Target unique sequences within icaD to prevent off-target effects

    • Consider the GC content and secondary structure of the target region

    • Design multiple gRNAs targeting different regions of icaD for validation

  • CRISPR Interference (CRISPRi): Using catalytically inactive Cas9 (dCas9) fused to transcriptional repressors allows for tunable repression of icaD expression without permanent genetic modification, enabling studies of dose-dependent effects.

  • Base Editing Applications: CRISPR base editors can introduce specific point mutations in icaD without double-strand breaks, allowing for precise structure-function studies of conserved residues.

  • Temporal Control Systems: Inducible CRISPR systems enable time-resolved studies of icaD function during different phases of biofilm development.

What are the current challenges in structural characterization of IcaD and potential solutions?

Structural characterization of IcaD presents several challenges due to its nature as a small integral membrane protein. Current limitations and potential solutions include:

  • Protein Expression and Purification Challenges:

    • Challenge: Obtaining sufficient quantities of correctly folded IcaD

    • Solutions:

      • Use specialized membrane protein expression systems (e.g., C41/C43 E. coli strains)

      • Employ fusion partners (e.g., MBP, SUMO) to enhance solubility

      • Optimize detergent screening for extraction and purification

  • Crystallization Difficulties:

    • Challenge: Membrane proteins are notoriously difficult to crystallize

    • Solutions:

      • Lipidic cubic phase crystallization methods

      • Co-crystallization with antibody fragments to provide crystal contacts

      • Construct design to remove flexible regions while maintaining function

  • Functional Complex Formation:

    • Challenge: IcaD functions in complex with IcaA

    • Solutions:

      • Co-expression and co-purification strategies

      • Chemical crosslinking to stabilize transient interactions

      • Nanobody-based stabilization of protein complexes

  • Alternative Structural Approaches:

    • Challenge: X-ray crystallography limitations

    • Solutions:

      • Cryo-electron microscopy for membrane protein complexes

      • NMR studies on isotopically labeled IcaD in membrane mimetics

      • Hydrogen-deuterium exchange mass spectrometry for dynamics and interaction studies

Recent advances in membrane protein structural biology, particularly the revolution in cryo-EM technology, offer promising avenues for overcoming these challenges to reveal the structural basis of IcaD function in PNAG synthesis.

How conserved is IcaD across different bacterial species?

IcaD shows significant conservation across various bacterial species, particularly within the Staphylococcus genus. Comparative genomic analyses reveal:

  • Staphylococcal Conservation: IcaD is highly conserved among biofilm-forming staphylococci, including S. aureus, S. epidermidis, and other coagulase-negative staphylococci. This conservation extends to both sequence and functional domains essential for interaction with IcaA.

  • Functional Homologs in Other Genera: Proteins functionally analogous to IcaD exist in other biofilm-forming bacteria, such as the PgaD protein in E. coli, which is part of the pgaABCD operon responsible for poly-β-1,6-N-acetylglucosamine synthesis .

  • Domain Architecture Conservation: The transmembrane topology and key functional domains of IcaD show conservation patterns that correlate with the ability to form PNAG-dependent biofilms across different bacterial species.

  • Selective Pressure: Evolutionary analysis suggests that IcaD is under purifying selection in pathogenic staphylococci, highlighting its essential role in biofilm formation and bacterial survival in host environments.

Understanding the conservation patterns of IcaD provides insights into the evolutionary history of biofilm formation mechanisms and can guide the development of broad-spectrum anti-biofilm strategies targeting conserved features of this protein.

What functional differences exist between IcaD and similar proteins in non-staphylococcal species?

While IcaD and its homologs share core functions in exopolysaccharide synthesis, important differences exist between staphylococcal IcaD and similar proteins in other bacterial species:

  • Structural Variations: Comparative analysis reveals differences in protein size, membrane topology, and domain organization between IcaD and non-staphylococcal homologs like PgaD in E. coli.

  • Interaction Partners: Although IcaD functions with IcaA in staphylococci , homologous proteins in other bacteria interact with their respective glycosyltransferases with different binding modes and regulatory mechanisms.

  • Substrate Specificity: The IcaA-IcaD complex in staphylococci shows specific preferences for UDP-GlcNAc as a substrate, while homologous complexes in other bacteria may exhibit different substrate specificities or catalytic efficiencies.

  • Regulatory Integration: The regulation of icaD expression in staphylococci is integrated into specific virulence networks , whereas homologous proteins in environmental bacteria may be regulated by different environmental cues relevant to their ecological niches.

  • Post-translational Modifications: Evidence suggests potential differences in post-translational modifications that may affect protein stability, localization, or function between IcaD and its homologs.

These functional differences highlight the evolutionary adaptations of PNAG synthesis machinery to different bacterial lifestyles and host environments, providing insights into the specialization of biofilm formation mechanisms across bacterial species.

What are the most effective purification strategies for recombinant IcaD protein?

Purifying recombinant IcaD presents challenges due to its transmembrane nature. The following strategies have proven effective:

StrategyKey ComponentsAdvantagesLimitations
Affinity PurificationHis6-tag or Strep-tag IIHigh specificity, single-step enrichmentTag may interfere with function
Detergent SolubilizationDDM, LMNG, or digitoninMaintains membrane protein foldingDetergent micelles can interfere with downstream applications
Nanodisc ReconstitutionMSP proteins, synthetic lipidsNative-like membrane environmentComplex reconstitution process
Co-expression with IcaADual expression vectorsImproved stability, native complexComplicates purification process
Membrane Scaffold ProteinsSMALPs, amphipolsDetergent-free purificationLimited compatibility with some techniques

For optimal results, a hybrid approach is recommended:

  • Initial solubilization with mild detergents like DDM

  • Affinity purification using N- or C-terminal tags (position chosen to minimize functional interference)

  • Size-exclusion chromatography to remove aggregates and free detergent

  • Optional reconstitution into nanodiscs or liposomes for functional studies

When co-purifying with IcaA for functional studies, consider dual-affinity tagging systems with orthogonal purification steps to ensure isolation of the intact complex.

How can researchers effectively analyze IcaD-IcaA interactions in experimental settings?

Investigating the critical interaction between IcaD and IcaA requires specialized approaches suited to membrane protein complexes:

  • Co-Immunoprecipitation (Co-IP): Using antibodies against either IcaD or IcaA to pull down the protein complex. This approach can be enhanced by:

    • Crosslinking before cell lysis to stabilize transient interactions

    • Using detergent conditions that preserve membrane protein complexes

    • Western blot analysis with antibodies specific to the partner protein

  • Förster Resonance Energy Transfer (FRET): By tagging IcaD and IcaA with compatible fluorophores (e.g., CFP and YFP), researchers can monitor protein interactions in living cells through energy transfer when the proteins are in close proximity.

  • Surface Plasmon Resonance (SPR): Immobilizing one protein (typically IcaA due to its larger size) on a sensor chip and flowing the partner protein over it allows for real-time measurement of binding kinetics.

  • Bacterial Two-Hybrid Systems: Modified for membrane proteins, these genetic systems can detect protein interactions through reporter gene activation when the membrane proteins interact.

  • Native Mass Spectrometry: Recent advances in membrane protein mass spectrometry enable direct observation of intact membrane protein complexes, providing information about stoichiometry and stability.

  • Functional Complementation Assays: Co-expressing wildtype and mutant versions of IcaD and IcaA in various combinations can reveal functional domains required for successful interaction and PNAG synthesis.

These methodologies, often used in combination, provide complementary information about the IcaD-IcaA interaction that is essential for understanding PNAG synthesis and biofilm formation.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.