Recombinant Polynucleobacter necessarius ATP synthase subunit b (atpF)

Shipped with Ice Packs
In Stock

Description

Biological Role in Polynucleobacter

ATP synthase subunit b is essential for energy metabolism in both free-living and symbiotic strains of P. necessarius:

  • Free-living strain: Utilizes ATP synthase to generate ATP via oxidative phosphorylation, relying on electron donors like hydrogen sulfide .

  • Symbiotic strain: Retains ATP synthase despite severe genome reduction, enabling energy production within its ciliate host (Euplotes) .

  • Functional conservation: The subunit’s role in proton translocation is retained even as other metabolic pathways (e.g., glycolysis, amino acid biosynthesis) are lost in the symbiont .

Research Applications

This recombinant protein is widely used in:

  • Enzyme kinetics: Studying ATP synthase’s proton-driven rotational mechanism .

  • Antibody development: Generating antibodies for Western blotting and ELISA .

  • Structural biology: Investigating membrane protein folding and interactions .

Comparative Genomic Insights

Genomic studies of P. necessarius reveal:

  • Genome reduction: The symbiotic strain lost DNA repair systems (e.g., translesion polymerases) but retained ATP synthase genes .

  • Metabolic dependency: The symbiont relies on host-derived metabolites but maintains ATP synthase for energy autonomy .

  • Evolutionary significance: ATP synthase conservation highlights its irreplaceable role, even in organisms with extreme genome streamlining .

Key Research Findings

  • Essentiality: ATP synthase is critical for P. necessarius survival, as its loss would disrupt energy homeostasis .

  • Structural resilience: The subunit’s transmembrane domains are conserved despite genomic decay in symbionts .

  • Biotechnological utility: Recombinant atpF simplifies large-scale production for industrial enzyme studies .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will accommodate your request as best as possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery information.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance for an additional fee.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. You can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage condition, buffer ingredients, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize your request.
Synonyms
atpF; Pnec_0018; ATP synthase subunit b; ATP synthase F(0 sector subunit b; ATPase subunit I; F-type ATPase subunit b; F-ATPase subunit b
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-156
Protein Length
full length protein
Species
Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Target Names
atpF
Target Protein Sequence
MNLNATLFAQMIVFFVLWWVVARFVWPPLVKALDERSSKIADGLAAAERGKEALALASNEAEQELNKARQEGVQRVAEAEKRAQMSAEEIRANAQAEAARVISQAQQDAAQQVTRAREVLRAEVAVLAVKGAEQILRREVDAKAHGQLLDQLKAEL
Uniprot No.

Target Background

Function
F(1)F(0) ATP synthase generates ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains: F(1) housing the extramembraneous catalytic core and F(0) containing the membrane proton channel. These domains are linked by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled to proton translocation through a rotary mechanism involving the central stalk subunits. This subunit is a component of the F(0) channel and forms part of the peripheral stalk, connecting F(1) to F(0).
Database Links
Protein Families
ATPase B chain family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is Polynucleobacter necessarius ATP synthase subunit b (atpF)?

Polynucleobacter necessarius ATP synthase subunit b (atpF) is a critical component of the F-type ATP synthase complex, specifically part of the F0 sector that anchors the complex in the bacterial membrane. This protein is encoded by the atpF gene and is also known by alternative names including ATP synthase F(0) sector subunit b, ATPase subunit I, and F-ATPase subunit b . The protein plays an essential role in cellular energy production by helping to form the stator that connects the membrane-embedded F0 portion to the catalytic F1 portion of the ATP synthase complex. The recombinant version has a UniProt accession number B1XSD0 and is derived from Polynucleobacter necessarius subsp. necessarius (strain STIR1) .

What preparation methods are recommended for the recombinant protein?

The recombinant P. necessarius ATP synthase subunit b should be briefly centrifuged prior to opening to bring contents to the bottom of the vial. For optimal results, reconstitute the protein in deionized sterile water to achieve a concentration of 0.1-1.0 mg/mL . For long-term storage stability, it is recommended to add glycerol to a final concentration of 5-50% (with 50% being the standard recommended concentration) before aliquoting for storage . When preparing working solutions, minimize freeze-thaw cycles as repeated freezing and thawing significantly compromises protein integrity. Working aliquots can be stored at 4°C for up to one week, but longer storage requires -20°C/-80°C conditions .

What are the optimal storage conditions for preserving protein function?

Storage conditions significantly impact the shelf life and functionality of recombinant P. necessarius ATP synthase subunit b. For liquid formulations, the shelf life is typically 6 months when stored at -20°C/-80°C, while lyophilized forms can remain stable for up to 12 months at -20°C/-80°C . Multiple factors influence stability including buffer composition, storage temperature, and the inherent stability of the protein itself . For extended storage periods, store the protein in Tris-based buffer with 50% glycerol that has been optimized for this specific protein . It is crucial to avoid repeated freeze-thaw cycles, which can cause protein denaturation and loss of function .

How is P. necessarius taxonomically classified?

Polynucleobacter necessarius was originally described as an essential endosymbiont living in the cytoplasm of the freshwater ciliate Euplotes aediculatus . The genus belongs to Betaproteobacteria and is characterized by organisms with low G+C contents (44-46 mol%), small genome sizes (1.5-2.5 Mbp), and a lack of motility . Taxonomically, P. necessarius is divided into two subspecies: P. necessarius subsp. necessarius, which includes obligate endosymbionts of E. aediculatus and E. harpa, and P. necessarius subsp. asymbioticus, which consists of obligately free-living strains . This taxonomic division reflects distinct lifestyle adaptations despite close phylogenetic relationships, with 16S rRNA sequence similarity between the endosymbiotic type strain and free-living isolates ranging from 99.1% to 99.4% .

What quality control parameters should be verified before experimental use?

Before using recombinant P. necessarius ATP synthase subunit b in experiments, researchers should verify several quality parameters. The commercially available recombinant protein typically has a purity of >85% as determined by SDS-PAGE . Researchers should confirm this purity level through gel electrophoresis upon receipt. Additionally, verify the protein's molecular weight against expected values and check for potential degradation products. For functional studies, preliminary assessment of proper folding through circular dichroism or limited proteolysis can provide confidence in protein quality. Since the protein is expressed in a yeast system , researchers should also be aware of potential post-translational modifications that may differ from those in the native bacterium.

How does ATP synthase subunit b function in the context of P. necessarius genome reduction?

ATP synthase subunit b in P. necessarius represents a fascinating case study in genome reduction while maintaining essential energy metabolism functions. Despite extensive genome streamlining in P. necessarius, ATP synthase components remain conserved, highlighting their critical role in cellular survival . The retention of ATP synthase machinery in the symbiotic P. necessarius, which has undergone significant genome reduction compared to its free-living relatives, indicates that energy conversion remains a non-negotiable function even as other metabolic pathways are lost . Researchers can use the recombinant subunit b to investigate how structural adaptations in this protein might compensate for the loss of interacting partners or regulatory elements that would be present in organisms with larger genomes. This provides an excellent model for studying protein evolution under genome reduction pressure.

What methods are effective for studying ATP synthase assembly in reduced-genome bacteria?

Studying ATP synthase assembly in genome-reduced bacteria like P. necessarius requires specialized approaches that account for the simplified protein interaction network. An effective methodological workflow includes:

  • Co-immunoprecipitation studies using recombinant subunit b as bait to identify retained interaction partners

  • In vitro reconstitution of partial ATP synthase complexes to assess assembly dependencies

  • Comparison of assembly kinetics between P. necessarius ATP synthase components and those from bacteria with larger genomes

  • Heterologous expression systems to test complementation of ATP synthase defects in model organisms

When working with recombinant P. necessarius subunit b, researchers should incorporate fluorescently-labeled variants to trace assembly intermediates through native gel electrophoresis or size exclusion chromatography. Cross-linking studies are particularly valuable for capturing transient interactions during assembly that may occur differently in this reduced-genome context.

How can recombinant atpF be used to study endosymbiont-host interactions?

The recombinant P. necessarius ATP synthase subunit b offers a unique tool for investigating endosymbiont-host energy dependencies. Since P. necessarius subsp. necessarius exists as an obligate endosymbiont in freshwater ciliates , its ATP production capacity directly influences host metabolism. Methodological approaches include:

  • In vitro binding assays between recombinant atpF and host ciliate extracts to identify potential interaction partners

  • Immunolocalization studies to determine if ATP synthase components localize to specific regions within the host cell

  • Functional complementation experiments using recombinant protein to rescue energy deficits in host cells with impaired endosymbionts

  • Comparative proteomics of ATP synthase complexes isolated from free-living versus endosymbiotic Polynucleobacter strains

These approaches can reveal adaptations in ATP synthase structure and function that facilitate the endosymbiotic lifestyle and potentially explain why P. necessarius became an essential endosymbiont for its ciliate hosts.

What are the implications of differences in atpF between the two P. necessarius subspecies?

The existence of two P. necessarius subspecies—one obligately endosymbiotic (subsp. necessarius) and one free-living (subsp. asymbioticus) —provides a valuable comparative system for examining functional adaptations in ATP synthase. Research questions that can be addressed using recombinant atpF from both subspecies include:

  • Do sequence variations in atpF correlate with different energy demands between free-living and endosymbiotic lifestyles?

  • How do post-translational modifications differ between the subspecies, potentially reflecting different regulatory environments?

  • Are there functional differences in ATP production efficiency between the ATP synthases of the two subspecies?

The amino acid sequences of ATP synthase subunit b from the two subspecies can be compared to identify positions under different selection pressures, potentially highlighting residues important for adaptation to the respective lifestyles. Functional studies using recombinant proteins from both subspecies can quantify differences in ATP production rates, proton translocation efficiency, and complex stability.

How does membrane composition affect P. necessarius ATP synthase function?

The membrane environment substantially impacts ATP synthase function, particularly for the membrane-embedded F0 sector containing subunit b. In P. necessarius, whose metabolism has undergone significant streamlining, the relationship between membrane composition and ATP synthase function presents a critical area of investigation. The symbiotic strain retains complete pathways for fatty acid synthesis despite losing many other metabolic capacities , suggesting the importance of proper membrane composition for essential functions like ATP synthesis.

Researchers can use the recombinant subunit b in reconstitution experiments with different lipid compositions to determine optimal functional environments. Systematic testing of membrane thickness, charge distribution, and specific lipid requirements would provide insights into how P. necessarius ATP synthase has adapted to function within the constraints of a reduced genome and potentially different membrane compositions in the endosymbiotic environment.

What is the recommended protocol for reconstituting ATP synthase activity in vitro?

Reconstituting functional ATP synthase activity using recombinant P. necessarius subunit b requires a systematic approach:

  • Prepare lipid vesicles using E. coli polar lipid extract or synthetic lipids mimicking bacterial membranes

  • Reconstitute recombinant subunit b along with other ATP synthase components (either native or recombinant)

  • Verify incorporation using freeze-fracture electron microscopy or fluorescently-labeled components

  • Establish a proton gradient using acid-base transition or bacteriorhodopsin co-reconstitution

  • Measure ATP synthesis activity using luciferase-based ATP detection systems

The reconstitution buffer should contain 20 mM Tris-HCl (pH 8.0), 100 mM KCl, 5 mM MgCl₂, and 1 mM DTT. Critical control experiments include omission of individual subunits to verify their necessity and the use of specific ATP synthase inhibitors to confirm that measured activity arises from the reconstituted complex.

What controls should be included when studying recombinant P. necessarius ATP synthase subunit b?

When conducting experiments with recombinant P. necessarius ATP synthase subunit b, the following controls are essential:

  • Negative controls:

    • Heat-denatured recombinant protein

    • Unrelated membrane protein of similar size and hydrophobicity

    • Buffer-only samples

  • Positive controls:

    • ATP synthase subunit b from well-characterized bacteria (E. coli)

    • Full ATP synthase complex when available

    • Synthetic peptides corresponding to known functional domains

  • Specificity controls:

    • ATP synthase subunit b from the alternate P. necessarius subspecies

    • Site-directed mutants affecting known functional residues

    • Cross-reactivity tests with antibodies against homologous proteins

These controls help distinguish between specific effects related to P. necessarius subunit b function and non-specific artifacts that might arise during experimental procedures.

How can researchers verify proper folding of recombinant P. necessarius ATP synthase subunit b?

Verifying proper folding of recombinant P. necessarius ATP synthase subunit b is critical for experimental reliability. A multi-technique approach is recommended:

  • Circular Dichroism (CD) Spectroscopy: Compare the secondary structure profile with predicted models and homologous proteins. The alpha-helical content should be prominent, particularly in the C-terminal domain.

  • Limited Proteolysis: Properly folded proteins show characteristic resistance patterns to proteolytic digestion. Compare digestion patterns with those of known correctly folded homologs.

  • Thermal Shift Assays: Monitor protein unfolding transitions using fluorescent dyes. Well-folded proteins typically show cooperative unfolding with distinct transition temperatures.

  • Functional Binding Assays: Test interaction with other ATP synthase subunits, particularly the delta and alpha subunits that interact with subunit b in the intact complex.

  • Size Exclusion Chromatography: Verify that the protein elutes at the expected molecular weight for the native state (typically dimeric for subunit b).

The recombinant protein should be tested immediately after reconstitution and again after storage to ensure stability under experimental conditions.

What strategies can overcome challenges in expressing recombinant membrane proteins from endosymbionts?

Expressing recombinant membrane proteins from endosymbionts like P. necessarius presents unique challenges due to their evolutionary adaptations and specialized membrane environments. Effective strategies include:

  • Codon optimization: Adjust codon usage for the expression host while preserving critical sequence features.

  • Fusion tags selection: N-terminal tags generally work better than C-terminal tags for membrane proteins. Consider using:

    • MBP (maltose-binding protein) for enhanced solubility

    • SUMO tag for improved folding

    • Twin-Strep-tag for gentle purification

  • Expression host selection: Yeast systems have proven successful for P. necessarius proteins , but also consider:

    • C41/C43 E. coli strains designed for membrane protein expression

    • Cell-free expression systems with added membrane mimetics

    • Insect cell systems for complex membrane proteins

  • Membrane mimetics during purification:

    • Detergent screening (start with mild detergents like DDM or LMNG)

    • Nanodiscs or SMALPs for maintaining native-like membrane environment

    • Amphipols for stabilizing membrane proteins after purification

  • Expression temperature and induction optimization:

    • Lower temperatures (16-20°C) often improve folding

    • Use lower inducer concentrations with longer expression times

These approaches address the particular challenges of expressing proteins from organisms with reduced genomes that have evolved within specialized host environments.

How can isotope labeling be applied to study P. necessarius ATP synthase structure?

Isotope labeling of recombinant P. necessarius ATP synthase subunit b enables advanced structural and interaction studies. A methodological workflow includes:

  • Expression system selection: E. coli or yeast expression systems in minimal media with controlled isotope sources are preferred.

  • Labeling strategies:

    • Uniform ¹⁵N labeling for basic NMR studies

    • ¹³C/¹⁵N double labeling for detailed structure determination

    • Selective amino acid labeling for studying specific interactions

    • Deuteration for larger complexes or solid-state NMR applications

  • Sample preparation considerations:

    • Higher protein concentrations (>0.2 mM) for NMR studies

    • Use of deuterated detergents to reduce background signals

    • Consideration of membrane mimetics compatible with NMR

  • Data collection methods:

    • Solution NMR for structural dynamics in detergent micelles

    • Solid-state NMR for studies in lipid bilayers

    • FRET studies using strategically labeled residues

  • Analysis approaches:

    • Chemical shift perturbation to map binding interfaces

    • Relaxation measurements to characterize dynamics

    • Distance restraints for structural model building

This methodology allows researchers to investigate the structural adaptations of ATP synthase components in P. necessarius that may reflect its specialized evolutionary history.

Why is P. necessarius considered a model organism for genome reduction studies?

Polynucleobacter necessarius represents an exceptional model for studying genome reduction due to several key characteristics:

  • Documented evolutionary trajectory: P. necessarius exists in both free-living and endosymbiotic forms, providing direct comparisons between related strains at different stages of genome reduction .

  • Intermediate genome reduction stage: With genome sizes of 1.5-2.5 Mbp , P. necessarius represents an intermediate stage of genome reduction, retaining more functions than extreme cases while showing clear streamlining patterns.

  • Experimental accessibility: The availability of culturable free-living strains (P. necessarius subsp. asymbioticus) alongside the endosymbiotic forms allows for comparative experimental approaches .

  • Essential endosymbiont status: As an essential endosymbiont for certain ciliates, P. necessarius demonstrates how genome reduction affects host-symbiont interdependencies .

  • Retention of key metabolic pathways: Despite genome reduction, P. necessarius maintains essential energy production machinery including ATP synthase, allowing researchers to study how core functions persist through reductive evolution .

The ATP synthase complex, including subunit b, offers a focused lens for examining how essential multisubunit complexes adapt during genome streamlining while maintaining their critical functions.

How does ATP synthase function relate to the endosymbiotic lifestyle of P. necessarius?

ATP synthase function is intricately linked to the endosymbiotic lifestyle of P. necessarius through several mechanisms:

  • Energy provision for host: As an obligate endosymbiont, P. necessarius likely contributes to the host's energy economy through ATP production, making ATP synthase function essential for the symbiotic relationship .

  • Metabolic integration: The endosymbiont has lost many metabolic pathways while retaining ATP synthase, suggesting that energy conversion remains a core function even as other capacities are relinquished to the host .

  • Adaptation to host environment: The ATP synthase must function within the specialized intracellular environment of the ciliate host, potentially operating under different conditions than in free-living bacteria.

  • Coordination with limited metabolism: The symbiotic P. necessarius lacks the glyoxylate cycle and has limited capacity to convert amino acids to glucose , indicating that ATP synthesis must coordinate with a streamlined metabolic network.

  • Evolutionary pressure: The maintenance of complete ATP synthase machinery despite genome reduction indicates strong selective pressure to maintain this function, highlighting its importance in the endosymbiotic relationship.

Research using recombinant subunit b can help elucidate how these adaptations manifest at the molecular level and contribute to our understanding of the evolutionary processes driving endosymbiosis.

What insights have been gained from comparing ATP synthase in the two P. necessarius subspecies?

Comparative analysis of ATP synthase between the two P. necessarius subspecies offers valuable insights into adaptation and evolution:

FeatureP. necessarius subsp. necessariusP. necessarius subsp. asymbioticusSignificance
Genome contextReduced genome (endosymbiont)Larger genome (free-living)Reveals essential gene neighborhood conservation
Regulatory elementsSimplified regulationMore complex regulationIndicates adaptation to stable vs. variable environments
Sequence conservationHigh conservation in catalytic regionsSimilar core with more variable regionsShows differential selection pressures
Expression levelPotentially constitutiveEnvironmentally responsiveReflects different energy demand patterns
Interaction partnersLimited interaction networkMore extensive interaction networkDemonstrates simplification of protein complexes

These comparisons reveal how ATP synthase components adapt to different lifestyles while maintaining core functionality, providing a window into the molecular changes that accompany the transition to an endosymbiotic lifestyle. The high degree of 16S rRNA similarity (99.1-99.4%) between the subspecies makes this system particularly valuable for identifying the specific genetic changes associated with lifestyle adaptation rather than general evolutionary divergence.

What is known about the atpF gene organization in P. necessarius?

The atpF gene in P. necessarius, encoding ATP synthase subunit b, exists within the larger ATP synthase operon structure, though with some notable features:

  • Operon organization: The atpF gene typically forms part of the ATP synthase operon that includes genes for other F0 and F1 subunits. In genome-reduced bacteria like P. necessarius, this operon structure is generally preserved despite the loss of many other operons and regulatory elements .

  • Conservation pattern: While many genes have been lost during the genome reduction process in P. necessarius, the ATP synthase genes including atpF show strong conservation, indicating their essential function .

  • Regulatory elements: The endosymbiotic P. necessarius shows a general trend of lost regulatory capacity , suggesting that atpF expression may be more constitutive compared to free-living relatives where ATP production might need to respond to changing environmental conditions.

  • Sequence characteristics: In Polynucleobacter sp. strain QLW-P1DMWA-1, the atpF gene is designated as Pnuc_0022 , indicating its position near the beginning of the chromosome, which often correlates with essential, highly expressed genes in bacteria.

  • Intergenic regions: The genome reduction process in P. necessarius has generally led to shortened intergenic regions , potentially affecting the spacing between atpF and adjacent genes in the ATP synthase operon.

Understanding these genomic features provides context for interpreting the function and evolution of ATP synthase subunit b in this system.

How does P. necessarius ATP synthase relate to bacterial energy metabolism evolution?

P. necessarius ATP synthase offers a unique window into bacterial energy metabolism evolution, particularly in the context of genome reduction:

  • Core function preservation: Despite extensive genome reduction, P. necessarius retains complete ATP synthase machinery, confirming this complex as part of the minimal essential gene set for bacterial life .

  • Metabolic dependency shifts: While many peripheral metabolic pathways have been lost in the endosymbiotic form, energy generation via ATP synthase remains critical, suggesting a fundamental need for autonomous energy production even in highly integrated endosymbionts .

  • Structural adaptation: Comparison of ATP synthase components between the subspecies and with other bacteria reveals how this complex adapts while maintaining core functionality, providing insights into the structural elements most critical for function.

  • Regulatory simplification: The general trend of regulatory simplification in P. necessarius likely extends to ATP synthase regulation, offering a model for studying how energy production adapts to more stable environments.

  • Membrane-protein co-evolution: The retention of fatty acid synthesis pathways alongside ATP synthase in P. necessarius highlights the co-evolutionary relationship between membrane composition and membrane protein function in bacterial evolution .

These relationships make P. necessarius ATP synthase an excellent model for understanding the fundamental constraints and adaptations in bacterial energy metabolism throughout evolutionary transitions.

What are common challenges when working with recombinant ATP synthase components?

Researchers working with recombinant P. necessarius ATP synthase subunit b may encounter several challenges:

  • Protein aggregation: The hydrophobic regions of subunit b can promote aggregation during expression and purification. Solution: Optimize detergent selection and concentration; consider fusion partners that enhance solubility.

  • Loss of structure during reconstitution: The protein may denature during buffer exchanges or concentration steps. Solution: Avoid harsh concentration methods; maintain detergent above critical micelle concentration throughout all steps.

  • Low expression yields: Membrane proteins often express poorly in heterologous systems. Solution: Test multiple expression systems (E. coli, yeast, insect cells); optimize codon usage; consider reduced expression temperature (16-20°C).

  • Incomplete reconstitution into membranes: Inefficient incorporation into experimental membrane systems. Solution: Optimize lipid:protein ratios; ensure gradual detergent removal; verify incorporation using fluorescent labeling or freeze-fracture electron microscopy.

  • Functional heterogeneity: Inconsistent activity between preparations. Solution: Implement rigorous quality control via circular dichroism or thermal shift assays; standardize purification protocols; use internal standards for activity measurements.

These challenges require methodical troubleshooting and careful optimization of protocols specific to this unique protein from a genome-reduced bacterium.

How can researchers resolve contradictory results in P. necessarius ATP synthase studies?

When encountering contradictory results in studies of P. necessarius ATP synthase, researchers should implement a systematic resolution approach:

  • Source verification: Confirm that the studied protein originated from the correct subspecies (necessarius vs. asymbioticus) and strain. Different Polynucleobacter strains may show variation in ATP synthase properties despite high 16S rRNA similarity .

  • Experimental condition differences: Document and compare all buffer conditions, pH, temperature, and ionic strength between contradictory studies. ATP synthase function is particularly sensitive to these parameters.

  • Protein quality assessment: Implement standardized quality metrics across laboratories:

    • Circular dichroism profiles

    • Thermal stability measurements

    • SDS-PAGE purity assessment

    • Mass spectrometry verification

  • Functional assay standardization: Develop consensus protocols for key assays:

    • ATP synthesis/hydrolysis measurement methods

    • Proton translocation assays

    • Binding affinity determination

  • Collaborative cross-verification: Establish sample exchange between laboratories reporting contradictory results to test identical materials under different protocols.

By systematically addressing these factors, researchers can identify whether contradictions stem from biological variation between Polynucleobacter strains or from methodological differences.

What future research directions are most promising for P. necessarius ATP synthase studies?

Several promising research directions can advance our understanding of P. necessarius ATP synthase:

  • Comparative structural biology: Solve high-resolution structures of ATP synthase components from both P. necessarius subspecies to identify adaptations associated with the endosymbiotic lifestyle.

  • In situ characterization: Develop methods to study ATP synthase function directly within the host ciliate environment, potentially using genetically encoded sensors or specialized microscopy techniques.

  • Minimal ATP synthase engineering: Use insights from the reduced P. necessarius system to design minimalist ATP synthase complexes with potential biotechnological applications.

  • Evolution of protein-protein interactions: Map the interaction network of ATP synthase in both subspecies to understand how multiprotein complexes evolve during genome reduction.

  • Functional complementation studies: Test whether ATP synthase components from the endosymbiotic form can complement defects in model organisms or vice versa to identify functional differences.

  • Host-symbiont energy exchange: Investigate the energetic contribution of P. necessarius ATP synthase to the host metabolism and determine how this shapes the obligate nature of the symbiosis.

These directions leverage the unique features of the P. necessarius system to address fundamental questions in biochemistry, evolution, and symbiosis research.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.