Recombinant Polynucleobacter necessarius NADH-quinone oxidoreductase subunit A (nuoA)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. Please specify your required tag type for preferential development.
Synonyms
nuoA; Pnec_0821; NADH-quinone oxidoreductase subunit A; NADH dehydrogenase I subunit A; NDH-1 subunit A; NUO1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-119
Protein Length
full length protein
Species
Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Target Names
nuoA
Target Protein Sequence
MNLANYFPVLLFILVGIGVGLVPMFLGKILAPSKPDAEKLSPYECGFEAFEDARMKFDVR YYLIAILFILFDLETAFLFPWGVALRDIGWLGYASMVIFLLEFIVGFVYIWKKGALDWE
Uniprot No.

Target Background

Function

NDH-1 facilitates electron transfer from NADH to quinones within the respiratory chain, utilizing FMN and iron-sulfur (Fe-S) centers as intermediaries. In this organism, ubiquinone is believed to be the primary electron acceptor. This redox reaction is coupled to proton translocation; four protons are translocated across the cytoplasmic membrane for every two electrons transferred, thereby conserving redox energy within a proton gradient.

Database Links
Protein Families
Complex I subunit 3 family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Polynucleobacter necessarius and why is it significant for research?

Polynucleobacter necessarius is a unique bacterial model system for studying genome reduction in both symbiotic and free-living organisms. This bacterium exists in two forms: as an obligate endosymbiont in freshwater ciliates (particularly Euplotes species) and as free-living strains in aquatic environments. The significance lies in the exceptional opportunity it provides to study an obligate symbiont alongside a closely related free-living organism that itself demonstrates a reduced genome and limited metabolism. This dual-lifestyle characteristic makes it an exceptionally useful model for investigations on symbiosis, genome evolution, and bacterial adaptation .

What is NADH-quinone oxidoreductase subunit A (nuoA) and what is its function?

NADH-quinone oxidoreductase subunit A (nuoA) is a component of Complex I in the electron transport chain. In Polynucleobacter necessarius, this protein (EC=1.6.99.5) functions as part of the NADH dehydrogenase I complex, also known as NDH-1 or NUO1. The protein plays a crucial role in energy metabolism by facilitating electron transfer from NADH to quinones, contributing to the establishment of a proton gradient across the membrane that drives ATP synthesis. The gene is identified as nuoA with the ordered locus name Pnec_0821 in the P. necessarius genome .

How should researchers design experiments to study the function of recombinant nuoA in vitro?

When designing experiments to study recombinant nuoA function in vitro, researchers should consider a multi-faceted approach:

  • Protein reconstitution in artificial membranes: Since nuoA is a membrane protein, it should be reconstituted in liposomes or nanodiscs to maintain its native conformation.

  • Electron transfer assays: Measure electron transfer rates using NAD(P)H as electron donors and various quinones as acceptors under different pH and temperature conditions.

  • Mutational analysis: Create site-directed mutations at conserved residues to identify functionally important amino acids.

  • Interaction studies: Use cross-linking experiments or co-immunoprecipitation to identify interactions with other subunits.

  • Design considerations: Follow principles of experimental design for big data analysis, including careful selection of controls and replicates to ensure statistical power .

For optimal results, researchers should employ a principled design approach similar to that described for big data analysis, where the design space is carefully considered to maximize information gain while minimizing experimental effort .

What are the optimal conditions for expression and purification of recombinant nuoA protein?

The optimal conditions for expression and purification of recombinant Polynucleobacter necessarius nuoA protein involve several critical considerations:

  • Expression system: E. coli strains optimized for membrane protein expression (such as C41(DE3) or C43(DE3)) are recommended due to the membrane-associated nature of nuoA.

  • Culture conditions:

    • Induction at low temperatures (16-18°C)

    • Extended expression periods (16-24 hours)

    • Lower IPTG concentrations (0.1-0.5 mM)

  • Membrane extraction: Gentle detergent solubilization using mild detergents like n-dodecyl-β-D-maltoside (DDM) or digitonin.

  • Purification approach:

    • Affinity chromatography (utilizing the tag added during recombinant production)

    • Size exclusion chromatography to ensure homogeneity

    • Ion exchange chromatography for further purification

  • Storage buffer: Tris-based buffer with 50% glycerol has been reported as suitable for long-term storage, with the protein remaining stable at -20°C .

It's essential to verify protein functionality after purification through activity assays that measure electron transfer capability.

How can researchers utilize recombinant nuoA to investigate the evolution of energy metabolism in symbionts versus free-living bacteria?

Investigating the evolution of energy metabolism using recombinant nuoA requires a comparative approach:

  • Comparative sequence analysis: Compare nuoA sequences from both symbiotic and free-living strains of P. necessarius to identify mutation patterns. Researchers should calculate nonsynonymous and synonymous mutation rates to detect selection pressures.

  • Functional reconstitution: Express and purify nuoA from both lifestyles and measure biochemical parameters like substrate affinity, catalytic efficiency, and thermal stability.

  • Metabolic integration: Study how nuoA function differs within the context of the complete metabolic network of each lifestyle, considering the streamlined genome and reduced metabolic flexibility of both forms.

  • Genome context analysis: Examine the genomic neighborhood of nuoA in different strains to identify co-evolved genes or regulatory elements.

  • Experimental evolution: Subject free-living strains to conditions that might select for symbiont-like traits and monitor changes in nuoA sequence and function.

This approach leverages the unique Euplotes-Polynucleobacter system, which provides an exceptional opportunity to study parallel evolution in related bacteria with different lifestyles . The presence of both forms allows researchers to directly compare adaptations rather than relying solely on phylogenetic inference.

What experimental approaches can resolve the potential role of nuoA in adaptation to different environmental conditions?

To investigate nuoA's role in environmental adaptation, researchers should consider:

  • Environmental gradient experiments: Express recombinant nuoA from different P. necessarius strains and test activity across pH, temperature, and osmolarity gradients.

  • Comparative genomics with phenotypic correlation: Analyze nuoA sequences from strains isolated from different habitats (like P. acidiphobus) and correlate sequence variations with habitat parameters .

  • Complementation studies: Introduce nuoA variants into model organisms lacking the native gene to assess functional restoration under different conditions.

  • Protein engineering: Create chimeric proteins by swapping domains between nuoA variants from different environmental isolates to identify adaptation-relevant regions.

  • Transcriptional response analysis: Measure expression levels of nuoA in different conditions to understand regulatory adaptations.

These approaches would be particularly revealing when comparing strains from subcluster PnecB2 (like P. acidiphobus) with other Polynucleobacter species, as they exhibit different environmental preferences and adaptations .

How can researchers address the challenges of working with membrane proteins like nuoA in structural studies?

Working with membrane proteins like nuoA presents unique challenges in structural studies that can be addressed through:

  • Protein stabilization strategies:

    • Use of novel detergents or nanodiscs to maintain native conformation

    • Addition of specific lipids that enhance stability

    • Engineering fusion proteins with soluble domains to improve crystallization

  • Alternative structural determination methods:

    • Cryo-electron microscopy for structure determination without crystallization

    • Solid-state NMR for membrane-embedded proteins

    • Hydrogen-deuterium exchange mass spectrometry for dynamics studies

  • Computational approaches:

    • Molecular dynamics simulations to study conformational changes

    • Homology modeling based on related structures from other bacterial species

    • Integration of experimental data with computational predictions

  • Functional verification:

    • Development of activity assays that can be performed in different detergent/lipid environments

    • Correlation of structural features with biochemical data

For nuoA specifically, researchers might consider co-expression with interacting subunits to stabilize the protein and improve the chances of obtaining structural information in a more native-like context.

What statistical approaches are most appropriate for analyzing data from nuoA functional studies?

When analyzing data from nuoA functional studies, researchers should consider these statistical approaches:

  • For comparative enzymatic studies:

    • ANOVA or mixed-effects models for comparing activity across conditions

    • Non-linear regression for enzyme kinetics parameters

    • Bayesian approaches for integrating prior knowledge with experimental data

  • For omics-based studies:

    • Dimension reduction techniques for high-dimensional data

    • Network analysis for contextualizing nuoA within metabolic pathways

    • Principled design approaches for sub-sampling large datasets

  • For structure-function studies:

    • Multiple sequence alignment with evolutionary trace analysis

    • Statistical coupling analysis to identify co-evolving residues

    • Regression models for correlating structural features with functional parameters

A comparative analysis of statistical methods applied to P. necessarius data could look like:

Statistical MethodApplicationAdvantagesLimitations
Bayesian optimizationParameter estimation in enzyme kineticsAccounts for prior knowledgeComputationally intensive
Mixed-effects modelsComparing nuoA function across strainsAccounts for strain-specific random effectsRequires careful model specification
Principled experimental designSelecting optimal conditions for testingMaximizes information gainMay miss unexpected phenomena outside design space
Dimension reductionAnalysis of high-throughput dataSimplifies complex datasetsMay lose important subtle patterns

Researchers should select appropriate methods based on their specific research question, sample size, and data characteristics .

How might research on nuoA contribute to understanding genome reduction in both symbiotic and free-living bacteria?

Research on nuoA can significantly contribute to understanding genome reduction through:

  • Comparative functional analysis: Detailed biochemical characterization of nuoA from both symbiotic and free-living P. necessarius strains can reveal how proteins evolve under genome streamlining pressures. This could answer whether genome reduction leads to proteins with broader or narrower functional capabilities.

  • Regulatory network analysis: Studying how nuoA expression is regulated in each lifestyle can demonstrate how regulatory complexity changes during genome reduction.

  • Metabolic context investigation: Examining how nuoA functions within the reduced metabolic network of P. necessarius can reveal compensatory mechanisms that maintain essential functions despite genome loss.

  • Evolutionary rate analysis: Calculating the rates of synonymous and nonsynonymous substitutions in nuoA across the Polynucleobacter genus can identify signatures of selection during genome reduction.

  • Experimental evolution approaches: Manipulating selective pressures on P. necessarius in laboratory settings could allow real-time observation of genome reduction processes affecting nuoA.

The Euplotes-Polynucleobacter system provides a unique opportunity because it allows direct comparison between obligate symbionts and free-living bacteria that themselves possess reduced genomes. This system confirms general patterns in symbiont genome evolution while providing new hypotheses about genome reduction in both lifestyles .

What are the potential applications of recombinant nuoA in developing new research tools for studying bacterial energy metabolism?

Recombinant nuoA protein has potential as a research tool for studying bacterial energy metabolism:

  • Biosensor development: Engineer nuoA-based sensors for real-time monitoring of electron transport chain activity in living cells.

  • Model system creation: Develop reconstituted systems containing purified nuoA and other respiratory complex components to study respiratory chain assembly and regulation.

  • Drug screening platform: Utilize recombinant nuoA in assays to identify compounds that specifically target bacterial respiratory complexes without affecting mitochondrial counterparts.

  • Teaching tools: Create educational kits using stable recombinant nuoA to demonstrate principles of membrane protein biochemistry and bioenergetics.

  • Synthetic biology applications: Incorporate nuoA variants with different properties into engineered bacteria to modify their bioenergetic capabilities.

These applications could be particularly valuable given the importance of the electron transport chain as an antibiotic target and the growing interest in manipulating bacterial metabolism for biotechnological purposes.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.