Recombinant Polynucleobacter necessarius Protease HtpX homolog (htpX)

Shipped with Ice Packs
In Stock

Description

Key Functional Partners

STRING analysis identified interacting proteins involved in membrane quality control and stress response :

  • def: Peptide deformylase

  • ftsH: ATP-dependent zinc metalloprotease

  • grpE: Protein-folding chaperone

  • Pnec_1775, Pnec_1774, Pnec_1773: Hypothetical membrane proteins

Pathway Involvement

  • ATF6-mediated chaperone activation: Maintains endoplasmic reticulum protein quality .

  • Apoptosome formation: Linked to caspase activation and apoptosis .

Evolutionary Conservation

Phylogenetic analysis revealed P. necessarius as the ancestral organism, with conserved residues critical for function :

Residue TypeCount
Conserved & exposed19
Conserved & buried38

These residues are evolutionarily constrained, suggesting essential roles in protease activity .

Recombinant Applications

The recombinant protein is commercially available for research (e.g., ELISA applications) :

  • Expression system: Escherichia coli (strain unspecified)

  • Storage: Tris-based buffer with 50% glycerol at -20°C or -80°C

  • Purity: Optimized via affinity chromatography

  • Applications: Study of membrane protease mechanisms, drug target validation, and host-pathogen interaction assays .

Research Implications

  • Therapeutic potential: Conservation of functional residues highlights HtpX as a target for inhibitors against endodontic infections .

  • Genomic insights: Comparative studies of P. necessarius strains reveal genome reduction patterns, aiding understanding of symbiotic vs. free-living bacterial evolution .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format that is currently in stock. However, if you have a specific format requirement, please include it in your order notes. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents settle at the bottom. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by several factors including storage conditions, buffer ingredients, storage temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please let us know, and we will prioritize development of the specified tag.
Synonyms
htpX; Pnec_1776; Protease HtpX homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-288
Protein Length
full length protein
Species
Polynucleobacter necessarius subsp. necessarius (strain STIR1)
Target Names
htpX
Target Protein Sequence
MFNFAKTAVLMAAITALFIVVGGMLGGEQGMLMALLMAVGMNFFSYWFSDTMVLKMTNAQ QVDERSAPQFYALVRELSEKAGLPMPKVFLIDEDAPNAFATGRNPDNASVAATIGVLKIL SNRELRGVMAHELAHVRHRDILISAVAATMAGAISALANFAMFFGGRDSEGRPNNPIASL MVAILAPIAASLIQMSISRAREYEADRGGAEISSDPEALAHALEKIHNYAQGTPFQAVEQ HPETAQMMILNPLTAGGLAQLFSTHPPTEERVARLMHMAKNGEYPGAN
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase M48B family
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is Protease HtpX homolog and what is its biological significance?

Protease HtpX homolog is a putative membrane-bound zinc metalloprotease that participates in the proteolytic quality control of membrane proteins in Polynucleobacter necessarius and related organisms . Its biological significance lies in its role in maintaining membrane protein integrity, with structural or functional disturbances potentially leading to infections, particularly endodontic infections in the context of oral microbiology . The protein's hydrophobic nature allows it to reside in and interact with biological membranes, creating a crucial interface for cellular function and pathogen-host interactions . Understanding this protein is essential as it represents a functional component in bacterial physiology that could be targeted for therapeutic interventions.

What are the key structural characteristics of Protease HtpX homolog?

The Protease HtpX homolog in Polynucleobacter necessarius consists of 288 amino acids in its full-length form, though related proteins in the study ranged from 279 to 336 amino acids . Physicochemical analysis reveals it is thermally stable and predominantly hydrophobic, which explains its membrane localization . The protein contains both conserved exposed residues (19) and conserved buried residues (38), suggesting functional importance of these regions . A notable feature is the presence of disordered regions (18.53-43.69%), which provide functional flexibility by allowing the protein to form linkers and macromolecular complexes that can attach to host cell receptors . This combination of stable structural regions and flexible disordered segments creates a versatile protein adapted to its membrane-associated proteolytic function.

How was the amino acid sequence of Protease HtpX homolog determined?

The amino acid sequence of Protease HtpX homolog was initially retrieved from UniProt databases, with the full sequence being: "MFNFAKTAVLMAAITALFIVVGGMLGGEQGMLMALLMAVGMNFFSYWFSDTMVLKMTNAQQVDERSAPQFYALVRELSEKAGLPMPKVFLIDEDAPNAFATGRNPDNASVAATIGVLKILSNRELRGVMAHELAHVRHRDILISAVAATMAGAISALANFAMFFGGRDSEGRPNNPIASLMVAILAPIAASLIQMSISRAREYEADRGGAEISSDPEALAHALEKIHNYAQGTPFQAVEQHPETAQMMILNPLTAGGLAQLFSTHPPTEERVARLMHMAKNGEYPGAN" . The methodological approach involved protein sequence retrieval from UniProt, followed by sequence homology search using UniProt BLAST to identify related proteins . Multiple sequence alignment using CLUSTALW was then performed to identify conserved regions and variations among homologous proteins, providing insights into potentially important functional domains . This methodical approach of database mining and comparative sequence analysis established the foundation for further structural and functional characterization of the protein.

What evolutionary insights can be derived from phylogenetic analysis of Protease HtpX homolog?

Phylogenetic analysis using MEGA11 revealed that Polynucleobacter necessarius was the ancestral organism for all the studied related species containing HtpX homologs . This ancestral positioning is particularly significant given that P. necessarius itself represents a unique evolutionary case study, as it contains both symbiotic and free-living strains despite having an already streamlined genome . The evolutionary clustering pattern observed among related organisms suggests they might share common pathogenic strategies developed through their evolutionary history . When examining the broader taxonomic context, P. necessarius consistently clusters with bacteria of the family Burkholderiaceae (Betaproteobacteria), either in a basal position or as a sister group to Ralstonia and Cupriavidus . This phylogenetic positioning helps explain the ecological success and adaptive capacity of these organisms despite their reduced genomic content, suggesting that core proteases like HtpX have been evolutionarily conserved while other genomic elements were lost.

How do the disordered regions in Protease HtpX homolog contribute to its function?

The disordered regions in Protease HtpX homolog, comprising 18.53-43.69% of the protein structure, play a crucial role in its functional capabilities . These intrinsically disordered segments provide conformational flexibility that allows the protein to:

  • Form adaptive linkers between structured domains

  • Assemble dynamic macromolecular complexes

  • Interact with varied binding partners

  • Attach efficiently to host cell receptors

From a methodological perspective, these regions were identified using the PONDR (Predictor Of Natural Disordered Regions) algorithm, which analyzes amino acid sequences to predict naturally disordered regions based on physiochemical properties . The presence of these disordered regions is particularly significant in membrane proteins like HtpX, as they can facilitate transitions between aqueous and lipid environments while maintaining catalytic function. In bacterial pathogens, such flexibility often correlates with virulence mechanisms, allowing proteins to adapt to different host environments and evade immune detection by presenting variable structural epitopes.

What is the significance of the conserved residues identified in Protease HtpX homolog?

The computational proteomic study identified 57 conserved residues in Protease HtpX homolog, categorized as 19 conserved and exposed residues and 38 conserved and buried residues . These conserved residues were identified through ConSurf analysis, which estimates the evolutionary conservation of amino acid positions based on phylogenetic relationships between homologous sequences . The methodological significance lies in distinguishing between exposed and buried conserved residues:

  • Conserved exposed residues (19) likely represent functionally important sites for substrate recognition, catalytic activity, or protein-protein interactions

  • Conserved buried residues (38) typically contribute to structural stability and proper folding of the protein

These conserved residues represent potential targets for structure-based drug design, as they are less likely to mutate and develop resistance. Additionally, the higher proportion of conserved buried residues suggests strong evolutionary pressure to maintain the core structural integrity of this metalloprotease, even as peripheral regions may vary among species. This pattern of conservation provides insights into the protein's evolutionary constraints and functional priorities.

What computational tools and databases are most effective for studying Protease HtpX homolog?

For comprehensive investigation of Protease HtpX homolog, a multi-tool computational approach has proven most effective, as demonstrated in recent studies . The recommended methodological sequence includes:

  • Sequence retrieval and homology assessment:

    • UniProt for initial sequence retrieval

    • UniProt BLAST for sequence homology search with E-value thresholds < 0.001

  • Physicochemical characterization:

    • ProtParam for analyzing parameters like molecular weight, theoretical pI, amino acid composition, extinction coefficient, and GRAVY value

  • Structural analysis:

    • CLUSTALW for multiple sequence alignment

    • MEGA11 for molecular phylogenetic analysis using Maximum Likelihood method

  • Functional prediction:

    • VirulentPred for virulence prediction

    • PONDR for protein disorder prediction

    • Pathway Commons for pathway analysis

    • STRING for protein-protein interaction analysis

  • Evolutionary conservation analysis:

    • ConSurf for per-site evolutionary rate estimation

This integrated computational pipeline allows researchers to move from basic sequence information to detailed structural, functional, and evolutionary insights without requiring extensive wet-lab resources initially, though experimental validation remains essential for confirming in silico predictions.

How can recombinant Polynucleobacter necessarius Protease HtpX homolog be effectively expressed and purified?

To effectively express and purify recombinant Polynucleobacter necessarius Protease HtpX homolog (htpX), researchers should consider the following methodological approach based on the protein's characteristics:

  • Expression system selection:

    • Given the membrane-bound nature of HtpX, bacterial expression systems like E. coli BL21(DE3) with modifications for membrane protein expression are recommended

    • Consider specialized vectors containing tags that aid solubilization and purification

  • Expression optimization:

    • Lower temperatures (16-25°C) during induction to minimize inclusion body formation

    • Inclusion of mild detergents (0.5-1% n-dodecyl β-D-maltoside) in lysis buffers

    • Co-expression with chaperones to improve folding efficiency

  • Purification strategy:

    • Initial separation using affinity chromatography with appropriate tags

    • Size-exclusion chromatography to separate monomeric from aggregated forms

    • Ion-exchange chromatography for final polishing

  • Verification:

    • Western blotting for identity confirmation

    • Circular dichroism spectroscopy for secondary structure assessment

    • Activity assays to confirm proteolytic function

The stabilization of the recombinant protein is particularly important given its hydrophobic nature and the observed 18.53-43.69% disordered regions. Storage conditions should include 50% glycerol in Tris-based buffer at -20°C for short-term or -80°C for extended storage, with avoidance of repeated freeze-thaw cycles as noted in product specifications .

What techniques can be used to study the protein-protein interactions of Protease HtpX homolog?

Multiple complementary techniques can be employed to study the protein-protein interactions of Protease HtpX homolog with its functional partners (def, Pnec_1775, fmt, Pnec_1774, Pnec_1773, Pec_1772, ftsH, Pnec_1779, Pnec_1611, and grpE):

  • Computational approaches:

    • STRING database analysis for predicting functional associations

    • Molecular docking simulations using tools like HADDOCK or ClusPro

    • Molecular dynamics simulations to assess stability of predicted complexes

  • In vitro techniques:

    • Co-immunoprecipitation with tagged versions of HtpX

    • Pull-down assays using purified recombinant proteins

    • Surface plasmon resonance for binding kinetics determination

    • Isothermal titration calorimetry for thermodynamic parameters

  • In vivo approaches:

    • Bacterial two-hybrid assays adapted for membrane proteins

    • Proximity labeling methods such as BioID or APEX

    • Fluorescence resonance energy transfer (FRET) with fluorescently tagged proteins

  • Structural biology methods:

    • Cross-linking coupled with mass spectrometry (XL-MS) to identify interaction interfaces

    • Cryo-electron microscopy for visualizing larger complexes

    • X-ray crystallography for high-resolution structure determination (challenging for membrane proteins)

Combining these approaches provides a comprehensive understanding of how HtpX interacts with its functional partners in the context of membrane protein quality control, which is especially important given its role in proteolytic regulation.

How can researchers interpret the physicochemical properties of Protease HtpX homolog?

The interpretation of physicochemical properties of Protease HtpX homolog should focus on correlating these properties with the protein's functional role as a membrane-bound zinc metalloprotease. The following analytical framework is recommended:

PropertyObserved ValueFunctional Interpretation
Amino acid length288 aa (full protein)Typical size for membrane proteases with multiple transmembrane domains
pH rangeSlightly acidic to basicVersatility in different cellular compartments
Thermal stabilityHighResistance to denaturation during infection and stress conditions
HydrophobicityHighFacilitates membrane insertion and substrate recognition within lipid bilayers
Disordered regions18.53-43.69%Enables flexibility for diverse substrate interactions and complex formation
Conserved residues57 total (19 exposed, 38 buried)Indicates functionally critical regions that maintain activity across species

Researchers should note that the slightly acidic to basic nature of the protein suggests it can function across various cellular pH environments, which is relevant for a pathogen that may encounter different host conditions . The high thermal stability indicates evolutionary adaptation to persist during temperature fluctuations and host inflammatory responses. The hydrophobicity profile should be analyzed using hydropathy plots to predict transmembrane segments, which would inform structural models and guide mutagenesis studies of functional domains.

What can be inferred from the non-virulent classification of Protease HtpX homolog?

The classification of Protease HtpX homolog as non-virulent by VirulentPred analysis requires careful interpretation within the broader context of bacterial pathogenesis . Several key inferences can be drawn:

  • Indirect contribution to pathogenesis: Though not directly virulent, HtpX likely contributes to pathogenesis indirectly through:

    • Maintenance of membrane protein homeostasis during stress conditions encountered during infection

    • Quality control of actual virulence factors that may be membrane-associated

    • Adaptation to changing host environments by regulating membrane composition

  • Evolutionary conservation: The non-virulent classification aligns with the observed conservation of HtpX across both pathogenic and non-pathogenic bacteria, suggesting a fundamental role in bacterial physiology rather than a specialized virulence function .

  • Therapeutic targeting considerations: While not a virulence factor per se, HtpX may represent an attractive therapeutic target precisely because:

    • It performs essential cellular functions

    • It shows high conservation (less prone to resistance-conferring mutations)

    • Inhibition would affect bacterial viability without directly targeting virulence mechanisms that are under strong selective pressure

  • Methodological limitations: Researchers should recognize the limitations of computational virulence prediction tools, which typically focus on classic virulence-associated sequence motifs but may miss proteins that contribute to pathogenesis through less direct mechanisms.

This interpretation highlights why proteins classified as non-virulent may still be relevant to understanding and targeting bacterial infections, particularly in the context of endodontic infections associated with P. necessarius.

How should researchers analyze the evolutionary rate variations across different regions of the protein?

Analysis of evolutionary rate variations across Protease HtpX homolog requires a structured approach that integrates multiple computational tools and biological interpretations:

  • Methodological approach:

    • Begin with ConSurf analysis to map conservation scores onto a structural model of the protein

    • Segment the protein into functional domains (transmembrane, catalytic, regulatory)

    • Calculate normalized evolutionary rates for each domain

    • Correlate conservation patterns with structural features and known functional regions

  • Interpretation framework:

    • Highly conserved regions (slow evolutionary rate) typically represent:

      • Catalytic sites essential for proteolytic activity

      • Zinc-binding motifs critical for metalloprotease function

      • Protein-protein interaction interfaces with conserved partners like ftsH

      • Structural elements maintaining proper protein folding

    • Variable regions (fast evolutionary rate) often indicate:

      • Substrate recognition sites that may vary between bacterial species

      • Surface loops exposed to selective pressure from host immunity

      • Regions that confer species-specific functional adaptations

  • Correlation with disorder predictions:

    • Analyze whether disordered regions (18.53-43.69%) correlate with higher evolutionary rates

    • Determine if disordered-to-order transitions upon binding correlate with conservation patterns

  • Statistical validation:

    • Apply statistical tests (e.g., Mann-Whitney U test) to determine if differences in evolutionary rates between functional domains are significant

    • Use randomization tests to ensure observed patterns aren't due to chance

This analytical approach provides insights into the functional constraints and adaptive flexibility of different protein regions, guiding targeted mutagenesis studies and structure-based drug design efforts for therapeutic development against endodontic infections.

What therapeutic strategies could be developed based on Protease HtpX homolog research?

Research on Protease HtpX homolog offers several promising avenues for therapeutic development against endodontic infections and potentially broader applications:

  • Structure-based inhibitor design:

    • Target the 19 identified conserved and exposed residues of HtpX using in silico screening of compound libraries

    • Design peptidomimetic inhibitors that compete with natural substrates

    • Develop allosteric modulators that bind to regulatory sites and alter protease activity

    • Focus on zinc-chelating compounds that would interfere with the metalloprotease function

  • Combination therapy approaches:

    • Pair HtpX inhibitors with conventional antibiotics to enhance efficacy

    • Target multiple components of the identified protein interaction network (HtpX plus partners like ftsH, def, grpE)

    • Develop dual-action compounds that simultaneously inhibit HtpX and disrupt membrane integrity

  • Vaccine development strategies:

    • Utilize the conserved exposed epitopes as potential vaccine candidates

    • Design chimeric antigens incorporating HtpX epitopes with other bacterial antigens

    • Explore mucosal vaccination strategies relevant to oral infections

  • Diagnostic applications:

    • Develop antibody-based detection methods for HtpX as biomarkers of P. necessarius infection

    • Create rapid PCR-based detection of htpX gene sequences for clinical samples

    • Design point-of-care diagnostics for endodontic infections based on HtpX detection

These therapeutic strategies require systematic validation through in vitro enzyme inhibition assays, bacterial growth inhibition studies, and eventually animal models of endodontic infection before advancing to clinical applications, with particular attention to specificity to avoid affecting host metalloproteases.

How might research on Polynucleobacter necessarius inform understanding of genome reduction in bacteria?

Research on Polynucleobacter necessarius and its Protease HtpX homolog provides a valuable model system for understanding the complex process of genome reduction in bacteria, offering several important research directions:

This research would contribute to fundamental questions in evolutionary biology regarding the minimum genetic requirements for bacterial life and the evolutionary trajectories of symbionts, while potentially revealing new antimicrobial targets that bacteria cannot easily eliminate through further genome reduction.

What methodological advances would enhance structural studies of Protease HtpX homolog?

Future structural studies of Protease HtpX homolog would benefit from several methodological advances to overcome the challenges associated with membrane-bound metalloproteases:

  • Advanced computational approaches:

    • Implementation of improved membrane protein structure prediction algorithms like AlphaFold-Membrane

    • Integration of molecular dynamics simulations in membrane mimetics to understand conformational flexibility

    • Development of specialized scoring functions for docking studies that account for the membrane environment

    • Machine learning models trained on membrane protease structures to predict substrate specificity

  • Innovative experimental methods:

    • Application of lipid nanodiscs for stabilizing HtpX in near-native membrane environments

    • Implementation of hydrogen-deuterium exchange mass spectrometry (HDX-MS) to map dynamic regions

    • Use of single-particle cryo-electron microscopy with improved detectors for membrane protein visualization

    • Development of photo-crosslinking approaches to capture transient substrate interactions

  • Hybrid structural biology strategies:

    • Integration of solid-state NMR data with computational models

    • Combination of small-angle X-ray scattering (SAXS) with crystallographic data of soluble domains

    • Correlative light and electron microscopy (CLEM) to visualize HtpX localization and dynamics

    • Native mass spectrometry of intact membrane complexes

  • In situ structural approaches:

    • Cryo-electron tomography to visualize HtpX in its native membrane context

    • In-cell NMR to detect structural changes under physiological conditions

    • Serial femtosecond crystallography using X-ray free-electron lasers for room-temperature structures

These methodological advances would provide crucial insights into how the structural features of HtpX—particularly the interplay between its conserved residues, disordered regions, and transmembrane segments—contribute to its function in membrane protein quality control and potentially inform structure-based drug design efforts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.