Recombinant Polynucleobacter sp. ATP synthase subunit b (atpF)

What is the ATP synthase subunit b (atpF) in Polynucleobacter sp. and what is its role in ATP synthesis?

ATP synthase subunit b (atpF) in Polynucleobacter sp. is a component of the F-type ATP synthase complex, specifically part of the peripheral stalk in the F₀ sector. This protein plays a crucial role in maintaining the structural integrity of the ATP synthase complex by connecting the membrane-embedded F₀ sector with the catalytic F₁ sector. The subunit b helps anchor the stationary parts of the enzyme while allowing the rotary components to turn, thereby enabling the coupling of proton translocation across the membrane to ATP synthesis.

In Polynucleobacter sp. (strain QLW-P1DMWA-1), the atpF gene encodes a 156 amino acid protein with the UniProt accession number A4SUT0 . The protein is also known by alternative names including ATP synthase F₀ sector subunit b, ATPase subunit I, F-type ATPase subunit b, or F-ATPase subunit b .

What is the functional significance of conserved domains in ATP synthase subunit b across bacterial species?

The ATP synthase subunit b contains several conserved domains that are critical for its function across bacterial species. Through comparative analysis with well-studied bacterial ATP synthases like those in mycobacteria, we can identify key functional regions:

• N-terminal transmembrane domain: This hydrophobic region anchors the subunit in the membrane and interacts with the a-subunit, helping to maintain the integrity of the proton channels necessary for ATP synthesis .

• Dimerization domain: This region allows two b-subunits (or b and b' in some species) to form a stable dimer, creating a rigid peripheral stalk.

• C-terminal domain: This region interacts with the F₁ sector, particularly with the α-subunits, providing stability to the entire ATP synthase complex during rotation .

In species like mycobacteria, unique structural features such as the fusion of b and δ subunits and duplicated domains contribute to specific modes of attachment to the catalytic α-subunits . While Polynucleobacter maintains separate b and δ subunits, the functional interactions between these components would be expected to follow similar principles.

What are the optimal conditions for expression and purification of recombinant Polynucleobacter sp. ATP synthase subunit b?

Based on established protocols for similar ATP synthase subunits, the following methodology is recommended for expression and purification of recombinant Polynucleobacter sp. ATP synthase subunit b:

Expression System:

• E. coli BL21(DE3) or similar strain optimized for membrane protein expression

• Expression vector containing a strong inducible promoter (T7, tac)

• Fusion tags such as His₆, MBP, or GST to facilitate purification

Culture Conditions:

• LB or 2XYT media supplemented with appropriate antibiotics

• Induction at OD₆₀₀ of 0.6-0.8 with 0.5-1.0 mM IPTG

• Post-induction growth at 16-18°C for 16-20 hours to minimize inclusion body formation

Purification Protocol:

• Cell lysis using sonication or French press in buffer containing 50 mM Tris-HCl pH 8.0, 300 mM NaCl, 10% glycerol, and protease inhibitors

• Membrane fraction isolation by ultracentrifugation

• Membrane protein solubilization using 1-2% detergent (DDM, LDAO, or Triton X-100)

• Affinity chromatography using the fusion tag

• Size exclusion chromatography for final purification

Storage Conditions:

• Store the purified protein in Tris-based buffer with 50% glycerol at -20°C for short-term storage or at -80°C for extended storage

• Avoid repeated freeze-thaw cycles

• Working aliquots can be stored at 4°C for up to one week

How can researchers effectively verify the structural integrity of purified recombinant Polynucleobacter sp. ATP synthase subunit b?

Verifying the structural integrity of purified recombinant Polynucleobacter sp. ATP synthase subunit b is critical for downstream applications. The following complementary techniques are recommended:

Primary Structure Verification:

• Mass spectrometry (LC-MS/MS) to confirm protein identity and sequence

• N-terminal sequencing to verify the absence of unwanted processing

• SDS-PAGE analysis to assess purity and approximate molecular weight

Secondary Structure Analysis:

• Circular dichroism (CD) spectroscopy to estimate α-helical content

• Fourier-transform infrared spectroscopy (FTIR) to analyze secondary structure elements

Tertiary Structure Assessment:

• Fluorescence spectroscopy to examine folding state

• Limited proteolysis to assess domain organization and accessibility

• Thermal shift assays to determine protein stability

Quaternary Structure Evaluation:

• Size exclusion chromatography combined with multi-angle light scattering (SEC-MALS)

• Native PAGE to assess oligomeric state

• Cross-linking studies to identify interaction surfaces

For membrane proteins like ATP synthase subunit b, additional techniques such as detergent screening and reconstitution into nanodiscs or liposomes may be necessary to maintain native-like conformation.

What methods are available for studying the interaction between ATP synthase subunit b and other components of the ATP synthase complex?

Several complementary approaches can be employed to study the interactions between ATP synthase subunit b and other components of the ATP synthase complex:

In vitro Protein-Protein Interaction Assays:

• Co-immunoprecipitation (Co-IP): Using antibodies against subunit b or other ATP synthase components to pull down interacting partners

• Pull-down assays: Using tagged recombinant subunit b as bait to capture interacting proteins

• Surface plasmon resonance (SPR): For quantitative binding kinetics between purified components

• Isothermal titration calorimetry (ITC): To determine thermodynamic parameters of binding

• Microscale thermophoresis (MST): For measuring interactions in solution with minimal sample consumption

Structural Analysis of Complexes:

• Cryo-electron microscopy (cryo-EM): For high-resolution structural analysis of the entire ATP synthase complex, similar to the approach used for mycobacterial ATP synthase

• Cross-linking mass spectrometry (XL-MS): To identify proximity relationships between subunits

• Hydrogen-deuterium exchange mass spectrometry (HDX-MS): To map interaction interfaces

Functional Assays:

• ATP synthesis/hydrolysis assays: To assess how mutations in subunit b affect enzymatic activity

• Proton translocation assays: Using pH-sensitive fluorophores to monitor proton movement

• Reconstitution studies: Incorporating purified subunits into liposomes to assess functional assembly

By combining these approaches, researchers can build a comprehensive understanding of how subunit b contributes to the structure and function of the ATP synthase complex.

How can researchers investigate the role of ATP synthase subunit b in the assembly and stability of the complete ATP synthase complex?

Investigating the role of ATP synthase subunit b in complex assembly and stability requires sophisticated experimental approaches:

Genetic Manipulation Strategies:

• Site-directed mutagenesis: Create specific mutations in conserved residues of subunit b to assess their impact on complex assembly

• Truncation variants: Generate N- or C-terminal truncations to determine minimal functional domains

• Domain swapping: Replace domains with homologous regions from other species to identify species-specific functions

• CRISPR-Cas9 genome editing: Create conditional knockdowns in native organisms to study in vivo effects

Assembly Monitoring Techniques:

• Pulse-chase experiments: Track the incorporation of newly synthesized subunit b into the ATP synthase complex

• Blue native PAGE: Analyze intact complexes and assembly intermediates

• Sucrose gradient ultracentrifugation: Separate complexes based on size and shape

• Single-molecule fluorescence microscopy: Visualize assembly dynamics in real-time

Stability Assessment Methods:

• Differential scanning calorimetry (DSC): Measure thermal stability of assembled complexes

• Chemical denaturation studies: Determine resistance to chaotropic agents

• Protease sensitivity assays: Compare degradation patterns of wild-type and mutant complexes

• Time-resolved structural studies: Monitor structural changes under different conditions

By integrating these approaches, researchers can determine how specific regions of subunit b contribute to the assembly pathway and structural integrity of the ATP synthase complex, similar to the insights gained from studies of mycobacterial ATP synthase .

What structural features of Polynucleobacter sp. ATP synthase subunit b contribute to its role in the peripheral stalk, and how do they compare to similar subunits in other bacterial species?

The structural features of Polynucleobacter sp. ATP synthase subunit b that contribute to its role in the peripheral stalk can be analyzed through comparative structural biology approaches:

Key Structural Features:

• N-terminal Membrane Anchor:

  • The first ~25 amino acids form a hydrophobic transmembrane helix

  • This region interacts with the a-subunit and helps position the peripheral stalk relative to the c-ring

• Dimerization Domain:

  • Coiled-coil regions facilitate dimerization with another b-subunit or b'-subunit

  • This dimerization creates a rigid structural support essential for countering the torque generated during ATP synthesis

• C-terminal F₁-Interaction Domain:

  • The C-terminal region interacts with the N-terminal regions of α-subunits

  • This interaction helps anchor the F₁ catalytic domain to the membrane F₀ domain

Comparative Analysis with Other Bacteria:

Unlike mycobacteria, where the b-subunit is fused with the δ-subunit (forming bδ) and works alongside a separate b'-subunit , Polynucleobacter appears to maintain separate b and δ subunits. The mycobacterial system is particularly distinctive because:

• The fused bδ-subunit contains a duplicated domain in its N-terminal region

• These duplicated domains participate in similar modes of attachment to two of the three N-terminal regions of the α-subunits

• The b'-subunit interacts with the third α-subunit

In contrast, Polynucleobacter likely follows the more typical bacterial arrangement where two b-subunits form a homodimer that interacts with the δ-subunit and the α-subunits. This structural difference may reflect adaptations to different environmental conditions or metabolic requirements.

How can molecular dynamics simulations enhance our understanding of ATP synthase subunit b function in Polynucleobacter sp.?

Molecular dynamics (MD) simulations offer powerful insights into the structural dynamics and functional mechanisms of ATP synthase subunit b that may be difficult to capture through experimental approaches alone:

Simulation Setup and Parameters:

• System Preparation:

  • Build a molecular model of Polynucleobacter sp. ATP synthase subunit b based on its amino acid sequence (MNLNATLFAQMIVFFVLWWVVARFVWPPLVKALDERSSKIADGLAAAERGKEALALASNEAEQELTKARQEGVQRVAEAEKRAQMSADEIRANAQAEAARIITQAKQDADQQVTSAREVLRAEVAVLAVKGAEQILRREVDAKAHGQLLDQLKAEL)

  • Embed the transmembrane region in a lipid bilayer mimicking bacterial membrane composition

  • Solvate the system with explicit water molecules and appropriate counterions

• Force Field Selection:

  • CHARMM36 or AMBER force fields optimized for membrane proteins

  • Lipid parameters matching bacterial membrane composition

• Simulation Protocols:

  • Energy minimization to resolve steric clashes

  • System equilibration (10-100 ns)

  • Production runs (1-10 μs) to capture relevant conformational changes

Key MD Analyses:

• Conformational Dynamics:

  • Root-mean-square deviation (RMSD) and fluctuation (RMSF) analyses to identify stable domains and flexible regions

  • Principal component analysis (PCA) to characterize major conformational modes

  • Hydrogen bond and salt bridge analysis to identify key stabilizing interactions

• Membrane Interactions:

  • Analysis of lipid-protein interactions at the transmembrane interface

  • Hydrophobic matching between the transmembrane helix and bilayer

  • Water penetration analysis at the membrane-protein boundary

• Interaction Modeling:

  • Simulations of the b-subunit dimer to characterize dimerization interface stability

  • Modeling interactions with other subunits (a, δ, α) to identify critical contact residues

  • Steered MD to investigate mechanical properties of the peripheral stalk

• Functional Insights:

  • Elastic network models to analyze how mechanical forces propagate through the structure

  • Potential of mean force calculations for key conformational transitions

  • Brownian dynamics simulations to model larger-scale motions of the peripheral stalk

These computational approaches can complement experimental studies by providing atomic-level insights into how the b-subunit's structure enables it to serve both as a membrane anchor and as a critical component of the stator that resists the torque generated during ATP synthesis.

What are common challenges in working with recombinant ATP synthase subunit b, and how can researchers overcome them?

Working with recombinant ATP synthase subunit b presents several challenges due to its membrane-associated nature and structural characteristics. Here are common issues and recommended solutions:

Challenge 1: Low Expression Yields

• Causes: Toxicity to host cells, protein instability, inefficient translation

• Solutions:

  • Use tightly controlled inducible expression systems

  • Lower induction temperature (16-18°C)

  • Try different E. coli strains (C41/C43 designed for membrane proteins)

  • Co-express with molecular chaperones (GroEL/GroES)

  • Optimize codon usage for the host organism

Challenge 2: Protein Aggregation and Inclusion Body Formation

• Causes: Improper folding, hydrophobic transmembrane regions

• Solutions:

  • Express as fusion with solubility-enhancing tags (MBP, SUMO)

  • Include mild detergents in lysis buffer

  • Develop refolding protocols if inclusion bodies cannot be avoided

  • Screen different solubilization conditions with various detergents

Challenge 3: Purification Difficulties

• Causes: Detergent interference with purification, co-purifying contaminants

• Solutions:

  • Screen multiple detergents compatible with purification methods

  • Incorporate additional purification steps (ion exchange, hydroxyapatite)

  • Use size exclusion chromatography as a final polishing step

  • Consider on-column detergent exchange during purification

Challenge 4: Protein Instability

• Causes: Loss of native lipid interactions, oxidation, proteolysis

• Solutions:

  • Include lipids or lipid-like molecules during purification

  • Add reducing agents to prevent oxidation

  • Use protease inhibitors throughout purification

  • Optimize buffer components (salt concentration, glycerol percentage)

  • Store in small aliquots at -80°C to avoid freeze-thaw cycles

How can researchers optimize structural studies of ATP synthase subunit b using cryo-electron microscopy?

Cryo-electron microscopy (cryo-EM) has revolutionized structural studies of membrane proteins like ATP synthase. Based on successful approaches with mycobacterial ATP synthase , here are optimizations for studying Polynucleobacter sp. ATP synthase subunit b:

Sample Preparation Optimization:

• Protein Purity and Homogeneity:

  • Achieve >95% purity through multi-step chromatography

  • Verify monodispersity using dynamic light scattering

  • Use GraFix (gradient fixation) to stabilize complexes if necessary

• Detergent and Buffer Screening:

  • Test multiple detergents (DDM, LMNG, GDN) for optimal micelle size

  • Screen buffer conditions (pH, salt, additives) for stability

  • Consider reconstitution into nanodiscs or amphipols to eliminate detergent micelles

• Grid Preparation:

  • Optimize protein concentration (typically 0.5-5 mg/mL)

  • Test different grid types (Quantifoil, C-flat) and hole sizes

  • Screen blotting times and conditions

  • Consider using graphene oxide or monolayer graphene supports

Data Collection Strategies:

• Microscope Settings:

  • Collect data at 300 kV for optimal resolution

  • Use energy filters to improve contrast

  • Implement beam-tilt correction for aberration-free imaging

  • Use movie mode acquisition with dose fractionation

• Automation and Throughput:

  • Employ automated data collection software

  • Implement on-the-fly data processing for quality control

  • Collect large datasets (>5,000 micrographs) to ensure sufficient particle numbers

Data Processing Approaches:

• Motion Correction and CTF Estimation:

  • Apply frame alignment algorithms to correct beam-induced motion

  • Estimate defocus accurately using CTFFIND4 or Gctf

• Particle Picking and Classification:

  • Use template-based or deep learning approaches for particle picking

  • Perform extensive 2D classification to eliminate poor particles

  • Apply 3D classification to identify conformational heterogeneity

  • Consider focused refinement on the peripheral stalk region

• High-Resolution Refinement:

  • Apply particle polishing and per-particle CTF refinement

  • Consider symmetry-expanded approaches if appropriate

  • Use masks to focus on specific domains

  • Apply Bayesian polishing and CTF refinement

By implementing these optimizations, researchers can potentially achieve high-resolution structures of Polynucleobacter sp. ATP synthase, similar to the 2.7-3.8 Å resolution achieved for the mycobacterial ATP synthase .

What experimental approaches can resolve apparent contradictions in ATP synthase subunit b structural data across different bacterial species?

When structural data from different bacterial species present contradictory information about ATP synthase subunit b, systematic experimental approaches can help resolve these discrepancies:

Comparative Structural Analysis Pipeline:

• Sequence-Structure Relationship Mapping:

  • Perform comprehensive multiple sequence alignments across diverse bacterial species

  • Identify conserved motifs versus species-specific regions

  • Map sequence conservation onto available structural models

  • Generate phylogenetic trees to relate structural differences to evolutionary distance

• Cross-Species Experimental Validation:

  • Express and purify subunit b from multiple species using identical protocols

  • Compare biochemical properties (oligomerization state, thermal stability)

  • Perform cross-linking studies with identical chemistry across species

  • Use hydrogen-deuterium exchange mass spectrometry to compare conformational dynamics

• Hybrid Protein Engineering:

  • Create chimeric proteins with domains from different species

  • Test functionality of chimeras in reconstituted systems

  • Identify domains responsible for species-specific differences

  • Perform targeted mutagenesis of non-conserved residues

• Multi-Technique Structural Integration:

  • Combine data from different structural techniques (X-ray crystallography, cryo-EM, NMR)

  • Validate structures with complementary methods like SAXS or AFM

  • Use integrative modeling to generate composite models that satisfy all experimental constraints

  • Employ molecular dynamics simulations to test structural stability across species

• Functional Correlation Studies:

  • Compare ATP synthesis/hydrolysis rates across species

  • Measure proton translocation efficiency

  • Assess peripheral stalk rigidity through single-molecule techniques

  • Correlate structural differences with functional adaptations to different ecological niches

By systematically applying these approaches, researchers can determine whether structural differences in ATP synthase subunit b across bacterial species represent genuine adaptations to different environments or artifacts of experimental techniques. For example, the unique features observed in mycobacterial ATP synthase, such as the fused bδ-subunit with duplicated domains , can be compared with the separate b and δ subunits in Polynucleobacter to understand functional adaptations.

How might structural insights from ATP synthase subunit b inform the development of new antimicrobial compounds?

ATP synthase has emerged as a promising target for antimicrobial development, particularly against bacteria like mycobacteria where it is essential for growth . Structural insights from ATP synthase subunit b across different bacterial species can inform drug discovery in several ways:

Target Site Identification:

• Species-Specific Structural Features:

  • The unique peripheral stalk architecture in different bacterial species

  • Species-specific interfaces between subunit b and other components

  • Differences in the organization of the b-subunit compared to human ATP synthase

• Functional Hotspots:

  • Regions critical for peripheral stalk stability

  • Interfaces essential for transmitting conformational changes

  • Sites involved in auto-inhibition mechanisms

Drug Discovery Strategies:

• Structure-Based Design:

  • Virtual screening against binding pockets identified in high-resolution structures

  • Fragment-based approaches targeting interface regions

  • Design of peptidomimetics that disrupt critical protein-protein interactions

• Allosteric Inhibitor Development:

  • Target sites that enhance native auto-inhibitory mechanisms

  • Develop compounds that destabilize the peripheral stalk

  • Design molecules that lock the enzyme in an inactive conformation

• Selectivity Enhancement:

  • Focus on structural elements absent in human ATP synthase

  • Target bacterial-specific regulatory mechanisms

  • Exploit differences in peripheral stalk composition and organization

Potential Advantages Over Existing Targets:

• Essential nature of ATP synthase for bacterial survival

• Established precedent with bedaquiline targeting mycobacterial ATP synthase

• Potential for reduced resistance development by targeting structural elements with limited mutational tolerance

• Opportunity for selective toxicity due to structural differences between bacterial and human ATP synthases

The mycobacterial ATP synthase has already demonstrated the potential of this approach, with features like the auto-inhibitory mechanism and the "fail-safe" mechanism involving the b'-subunit providing novel targets for antitubercular drug development .

What is the potential role of post-translational modifications in regulating ATP synthase subunit b function?

Post-translational modifications (PTMs) of ATP synthase subunit b represent an underexplored area that could significantly impact our understanding of ATP synthase regulation in bacteria:

Potential PTMs and Their Functional Implications:

• Phosphorylation:

  • Serine, threonine, and tyrosine residues in the cytoplasmic domain

  • Potential modulation of interactions with other subunits

  • May affect rigidity of the peripheral stalk

  • Could serve as a mechanism for rapid regulation of ATP synthase activity

• Acetylation:

  • Lysine residues at interaction interfaces

  • May alter electrostatic interactions with other subunits

  • Potential role in adapting to metabolic state changes

• Methylation:

  • Arginine and lysine residues in regulatory regions

  • May fine-tune protein-protein interactions

  • Could affect structural stability of coiled-coil domains

• Lipid Modifications:

  • Potential covalent attachment of lipids to enhance membrane anchoring

  • May affect lateral mobility in the membrane

  • Could influence interaction with membrane lipids

Methodological Approaches for PTM Investigation:

• PTM Detection and Mapping:

  • Mass spectrometry-based proteomics with enrichment strategies

  • Site-specific antibodies for common PTMs

  • Chemical labeling approaches for specific modifications

• Functional Impact Assessment:

  • Site-directed mutagenesis of modified residues

  • Generation of mimetic mutants (e.g., phosphomimetic)

  • Activity assays comparing native and modified forms

• Regulatory Mechanism Exploration:

  • Identification of enzymes responsible for adding/removing PTMs

  • Investigation of environmental triggers for modification

  • Temporal dynamics of modifications under different conditions

• Structural Consequences:

  • Crystallography or cryo-EM of modified versus unmodified forms

  • Molecular dynamics simulations to predict effects on structure

  • HDX-MS to detect changes in conformational dynamics

Understanding the PTM landscape of ATP synthase subunit b could reveal new layers of bacterial energy metabolism regulation and potentially identify novel targets for antimicrobial development.

How can systems biology approaches integrate ATP synthase subunit b research into broader understanding of bacterial energy metabolism?

Systems biology provides powerful frameworks to integrate research on ATP synthase subunit b into a comprehensive understanding of bacterial energy metabolism:

Multi-omics Integration Strategies:

• Transcriptomics-Proteomics Correlation:

  • Analyze co-expression patterns of atpF with other ATP synthase genes and energy metabolism components

  • Identify transcriptional regulators controlling ATP synthase expression

  • Compare mRNA and protein abundance under different growth conditions

• Metabolomics Connection:

  • Correlate ATP/ADP ratios with ATP synthase subunit expression and modification

  • Monitor metabolic flux changes in response to ATP synthase perturbation

  • Identify metabolite signatures associated with ATP synthase efficiency

• Interactomics Mapping:

  • Define the complete interaction network of ATP synthase subunit b

  • Identify unexpected interaction partners outside the ATP synthase complex

  • Map the dynamic changes in the interactome under different conditions

Mathematical Modeling Approaches:

• Kinetic Models:

  • Develop detailed kinetic models of ATP synthase incorporating structural information

  • Simulate the impact of subunit b modifications on ATP synthesis rates

  • Predict system responses to environmental perturbations

• Flux Balance Analysis:

  • Integrate ATP synthase function into genome-scale metabolic models

  • Predict growth phenotypes under different energy limitations

  • Identify synthetic lethal interactions with ATP synthase components

• Multi-scale Models:

  • Connect molecular dynamics of subunit b to whole-cell energetics

  • Model the relationship between membrane potential, proton gradient, and ATP synthesis

  • Integrate spatial organization of energy-generating systems

Evolutionary Systems Analysis:

• Comparative Genomics:

  • Analyze co-evolution of ATP synthase components across bacterial phylogeny

  • Identify lineage-specific adaptations in subunit b structure and function

  • Correlate genomic changes with ecological niches and energy acquisition strategies

• Horizontal Gene Transfer Assessment:

  • Investigate potential transfer of ATP synthase genes between bacterial species

  • Identify mosaic ATP synthase complexes with components from different evolutionary origins

  • Assess functional consequences of horizontal acquisition of novel ATP synthase components

By employing these systems biology approaches, researchers can place the structural and functional insights of ATP synthase subunit b within the broader context of bacterial physiology, adaptation, and evolution. This integrated understanding could reveal emergent properties not apparent from reductionist studies and identify novel strategies for antimicrobial development targeting bacterial energy metabolism.

What protein analysis tools and databases are most useful for researchers studying Polynucleobacter sp. ATP synthase subunit b?

Researchers studying Polynucleobacter sp. ATP synthase subunit b can leverage various computational resources and databases:

Sequence Analysis Resources:

• Primary Databases:

  • UniProt (A4SUT0): Comprehensive protein information including sequence, function, and modification data

  • NCBI Protein: Genomic context and related sequences

  • PDB: Repository of experimentally determined protein structures

  • EMBL-EBI: European collection of biological data

• Sequence Analysis Tools:

  • BLAST/PSI-BLAST: Identify homologous proteins across species

  • Clustal Omega/MUSCLE: Multiple sequence alignment for evolutionary analysis

  • HMMER: Profile hidden Markov models for remote homology detection

  • ConSurf: Conservation analysis mapped to structure

Structural Analysis Resources:

• Prediction Tools:

  • AlphaFold2/RoseTTAFold: State-of-the-art protein structure prediction

  • SWISS-MODEL: Homology modeling based on known structures

  • CABS-fold: Protein folding simulation and structure prediction

  • PSIPRED: Secondary structure prediction

• Structure Visualization and Analysis:

  • PyMOL/Chimera/VMD: Visualization and analysis of 3D structures

  • ProDy: Analysis of protein dynamics and structure

  • MDAnalysis: Analysis of molecular dynamics simulations

  • HOLE: Analysis of pores and channels in protein structures

Functional Annotation Resources:

• Domain and Motif Databases:

  • Pfam/InterPro: Protein domain and family classification

  • PROSITE: Protein domains, families, and functional sites

  • CDD: Conserved Domain Database

  • ELM: Eukaryotic Linear Motif resource

• Functional Prediction Tools:

  • SIFT/PolyPhen: Predict functional effects of amino acid substitutions

  • DCpred: Disease-causing mutation prediction

  • MutPred: Functional impact of amino acid substitutions

  • COACH/COFACTOR: Protein-ligand binding site prediction

ATP Synthase-Specific Resources:

• Specialized Databases:

  • TCDB: Transport protein classification database

  • ATPase Database: Collection of information on P-type ATPases

  • BRENDA: Comprehensive enzyme information system

  • SASBDB: Small-angle scattering biological data bank

These resources provide comprehensive tools for characterizing Polynucleobacter sp. ATP synthase subunit b from sequence to structure to function, enabling researchers to generate hypotheses for experimental validation and to place their findings in the broader context of ATP synthase research.

What experimental controls are essential when characterizing the function of recombinant ATP synthase subunit b?

Rigorous experimental controls are crucial for reliable characterization of recombinant ATP synthase subunit b function:

Expression and Purification Controls:

• Negative Controls:

  • Empty vector expression to identify host cell background proteins

  • Non-transformed host cells to establish baseline proteome

  • Purification of unrelated protein using identical protocol to identify non-specific binding

• Positive Controls:

  • Well-characterized homologous protein from model organism

  • Commercial ATP synthase components with verified activity

  • Previously validated preparation of the target protein

• Quality Control Checkpoints:

  • Mass spectrometry confirmation of protein identity

  • N-terminal sequencing to verify correct processing

  • Dynamic light scattering to assess monodispersity

  • Circular dichroism to confirm secondary structure

Functional Assay Controls:

• Biochemical Assay Controls:

  • Heat-denatured protein to establish background signal

  • Catalytically inactive mutant (if available)

  • Enzyme inhibitors to verify specificity of activity measurements

  • Time zero measurements to establish baseline

• Interaction Assay Controls:

  • Non-specific proteins to test binding selectivity

  • Competition assays with unlabeled components

  • Truncated constructs to map interaction domains

  • Flow-through fractions from pull-down assays

• Reconstitution Controls:

  • Empty liposomes/nanodiscs to establish baseline proton leakage

  • Individual subunits to demonstrate requirement for complex formation

  • Scrambled orientation controls for directional activities

  • Ionophore treatments to collapse proton gradients

Data Analysis Considerations:

• Statistical Validation:

  • Minimum of three biological replicates

  • Appropriate statistical tests with reported p-values

  • Outlier identification and handling procedures

  • Confidence interval reporting

• Normalization Approaches:

  • Total protein normalization

  • Internal standards for quantitative assays

  • Housekeeping proteins for comparative studies

  • Batch effect correction for multi-day experiments

By implementing these controls, researchers can ensure that observed effects are specifically attributable to the ATP synthase subunit b and not to experimental artifacts, contaminating proteins, or non-specific interactions.

How should researchers design experiments to investigate the evolutionary adaptations of ATP synthase subunit b across different bacterial species?

Designing comprehensive experiments to investigate evolutionary adaptations of ATP synthase subunit b requires a multi-faceted approach combining comparative genomics, structural biology, and functional characterization:

Experimental Design Framework:

• Phylogenetic Sampling Strategy:

  • Select representative species across major bacterial phyla

  • Include extremophiles adapted to different environmental conditions

  • Sample species with diverse metabolic strategies (aerobic/anaerobic)

  • Include closely related species pairs from different niches

• Sequence-Structure-Function Pipeline:

  Stage 1: Comparative Genomics

  • Perform comprehensive sequence alignments of atpF genes

  • Identify conserved versus variable regions

  • Calculate selection pressures (dN/dS ratios) across the gene

  • Map genomic context and operon structure across species

  Stage 2: Structural Comparisons

  • Determine or predict structures of subunit b from key species

  • Compare structural features across phylogenetic distances

  • Identify structural adaptations correlating with environmental factors

  • Map sequence conservation onto structural models

  Stage 3: Functional Characterization

  • Express and purify subunit b from representative species

  • Compare biochemical properties (stability, oligomerization)

  • Measure interaction affinities with partner subunits

  • Assess function in reconstituted systems

• Environmental Adaptation Analysis:

  • Correlate structural features with habitat parameters

  • Test thermal stability across thermophilic/psychrophilic species

  • Compare pH tolerance in acidophiles/alkaliphiles

  • Assess salt tolerance in halophilic variants

Experimental Techniques:

• Ancestral Sequence Reconstruction:

  • Computationally infer ancestral sequences of subunit b

  • Resurrect ancestral proteins through gene synthesis

  • Characterize properties of ancestral versus extant proteins

  • Identify key mutations driving functional divergence

• Domain Swapping Experiments:

  • Create chimeric proteins with domains from different species

  • Test functionality in heterologous expression systems

  • Identify domains responsible for specific adaptations

  • Map compatibility between components from different species

• Directed Evolution Approaches:

  • Subject subunit b to selection under defined conditions

  • Identify adaptive mutations enhancing function

  • Compare laboratory-evolved variants with natural diversity

  • Test whether convergent evolution occurs under similar pressures

• In vivo Cross-species Complementation:

  • Test functional exchangeability of subunit b across species

  • Identify species-specific incompatibilities

  • Measure fitness effects of heterologous expression

  • Determine minimum adaptations needed for cross-species functionality

By implementing this experimental framework, researchers can gain insights into how ATP synthase subunit b has evolved to meet the energetic demands of diverse bacterial lifestyles and environments, while maintaining its core function in the ATP synthase complex.