Recombinant Polynucleobacter sp. Membrane protein insertase YidC (yidC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please include your request in the order notes. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please contact your local distributors for specific delivery timeframes.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please notify us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is decided during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
yidC; Pnuc_2085; Membrane protein insertase YidC; Foldase YidC; Membrane integrase YidC; Membrane protein YidC
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-557
Protein Length
full length protein
Species
Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) (Polynucleobacter necessarius subsp. asymbioticus)
Target Names
yidC
Target Protein Sequence
MDFKKTILWAVFSLSGLMLYNNWQVHEGKPSMFGGAPATTASAPNKSGAPAKLDTPVAIS GIPSVTQTPTANSAPVESTQKFVLENELLSVEISAAGANVVDAKLLKELTADQKPVEIFQ HTPTHTYVARSGLVAVGNTDLPNHTSLFKLDRSGKDGSGRPFLVLSSERNGVKLEKTFLL NPGSYDIYVGHRVTQVTPNGAPLILYTEIVRDGSEEKKIGPFGGAFSASTFTGPAIYTDG GKYKKVSFADIEKNKFTAPSQIAAGQPGWVAMVQHYFASAWIPDDKLPRDIYSGKIDNDL YRVGMQTQLGTIATGTTVMANAQLFVGPQEERMLETIAPGLELLKDYGYLTILAKPIFWL LEHIHNIVGNWGWSIILLTVLIKLAFFPLSAASYKSMARMKEVQPRLAAMKEQYKGEPQK LNQAMMEMYRKEKINPLGGCLPVVIQIPVFISLYWVLLSSVEMRGAPWILWIHDLSVPDP YYILPVVMAVSMFVQTKLNPTPPDPVQAKVMMYMPIVFSIMFFFFPAGLVLYWVTNNLLS IAQQWQINRLFGKKPAK
Uniprot No.

Target Background

Function
Essential for the insertion and/or proper folding and/or complex formation of integral membrane proteins into the membrane. Involved in integrating membrane proteins that insert both dependently and independently of the Sec translocase complex, as well as at least some lipoproteins. Assists in folding multispanning membrane proteins.
Database Links
Protein Families
OXA1/ALB3/YidC family, Type 1 subfamily
Subcellular Location
Cell inner membrane; Multi-pass membrane protein.

Q&A

What is YidC and what is its fundamental role in bacterial cells?

YidC is a 60-kDa membrane protein insertase with six putative transmembrane helices that plays a critical role in the biogenesis of membrane proteins . It belongs to the conserved Alb3/Oxa1/YidC family, with homologues present in the inner membrane of mitochondria (Oxa1) and the thylakoid membrane of chloroplasts (Albino3) . YidC functions primarily in facilitating the insertion, folding, and assembly of various membrane proteins. The protein is essential for bacterial cell viability and interacts with components of the Sec translocon, particularly SecD and SecF, which interact with the SecYEG complex . YidC's most significant contribution appears to be in ensuring the proper folding of membrane proteins into their final tertiary conformation.

How does YidC's structure relate to its function in membrane protein biogenesis?

YidC's structure features multiple transmembrane segments that create a hydrophobic environment conducive to interactions with client membrane proteins. The protein's structure enables it to interact transiently with membrane proteins during their insertion phase, guiding them toward proper folding pathways . While the insertion mechanism does not strictly require YidC, the protein's structural arrangement allows it to serve as a crucial folding facilitator. The transmembrane domains create a protected environment that shields hydrophobic segments of nascent membrane proteins during their integration into the lipid bilayer, preventing misfolding and aggregation. This structural arrangement also facilitates YidC's interactions with other membrane components such as the Sec translocon and lipids like phosphatidylethanolamine (PE), which are known to contribute to proper membrane protein folding .

How can researchers distinguish between YidC's roles in membrane protein insertion versus folding?

Researchers can differentiate between insertion and folding functions through carefully designed in vitro and in vivo experiments. In vitro transcription/translation/insertion systems using isolated membrane vesicles with or without YidC provide direct evidence of YidC's role . For example, studies with lactose permease (LacY) demonstrated that while the protein could insert into YidC-depleted membranes, it failed to fold correctly as determined by conformational antibody binding assays .

To distinguish these roles methodologically:

  • Conduct parallel insertion assays with YidC-containing and YidC-depleted membranes

  • Use protease protection assays to verify membrane insertion

  • Apply conformation-specific antibodies that recognize properly folded structures

  • Employ functional assays that depend on correct protein folding and conformation

  • Monitor protein stability and solubility in various detergents as indicators of proper folding

When these approaches were applied to LacY, researchers found that insertion occurred in both membrane types, but conformational epitopes were only recognized in YidC-containing preparations, conclusively demonstrating YidC's folding-specific role .

What experimental evidence supports YidC's involvement in membrane protein folding?

Multiple lines of experimental evidence confirm YidC's critical role in membrane protein folding:

  • Conformational antibody studies: When LacY was expressed in vitro using YidC-depleted membranes, monoclonal antibodies directed against conformational epitopes showed poor binding, indicating improper folding .

  • Reconstitution experiments: LacY folded improperly in proteoliposomes prepared without YidC, but folded correctly when purified YidC was supplemented into the system .

  • In vivo fluorescence localization: While LacY-GFP localized to the membrane periphery in both YidC-depleted and YidC-containing cells, functional studies revealed differences in proper folding .

  • Enhanced biogenesis in YibN co-expression: YidC's interaction partner YibN significantly increased production of YidC-dependent substrates including M13 procoat (PC-Lep), Pf3 coat protein, and F0c, supporting YidC's role in effective membrane protein maturation .

These complementary approaches provide strong evidence that YidC plays a primary role in guiding membrane proteins to their final tertiary conformation via transient interactions during the insertion process.

Which membrane proteins are known YidC substrates and what determines substrate specificity?

Several membrane proteins have been identified as YidC substrates, with varying degrees of dependence on the insertase:

SubstrateStructureYidC DependenceExperimental Evidence
M13 procoat (PC-Lep)Single-pass with fused Lep domainHighEnhanced biogenesis with YibN co-expression
Pf3 coat proteinSingle-pass with fused Lep domainHigh1.5-1.8 fold stimulation in YibN-enriched membranes
F0c (ATP synthase subunit)Two transmembrane segmentsHighIncreased production with YibN
LacY (lactose permease)Multi-pass transporterModerate (for folding)Conformational antibody binding studies
SecGTwo transmembrane segmentsModerateEnhanced biogenesis with YibN, reduced with I20E mutation
YajCSingle-passLow/NoneNot affected by YibN overexpression
YhcBSingle-passLow/NoneNot affected by YibN overexpression

Substrate specificity appears to be determined by:

  • Transmembrane segment hydrophobicity (as evidenced by the SecG I20E mutation showing reduced YibN enhancement)

  • Topology complexity (with multi-pass proteins requiring more assistance)

  • Charge distribution in transmembrane segments

  • Specific recognition elements within transmembrane domains that facilitate YidC interaction

The experimental data suggest that proteins with highly hydrophobic transmembrane segments or complex folding requirements show greater dependence on the YidC system for proper biogenesis.

How does YidC interact with the YibN protein and what are the functional implications?

YidC forms a stable interaction with YibN, a 16 kDa single-pass inner membrane protein oriented toward the cytosol. This interaction has been validated through multiple complementary approaches:

  • Proximity-dependent biotin labeling (BioID): YibN was consistently identified with the highest spectral counts across four replicates when YidC was tagged with the BirA* biotin ligase .

  • Affinity pulldown with SILAC labeling: Reciprocal pulldown experiments showed >20-fold enrichment of YibN when His-tagged YidC was used as bait, and >50-fold enrichment of YidC when His-tagged YibN was used .

  • Native expression conditions: When chromosomally encoded YibN was tagged with an SPA tag, YidC was identified as one of the most abundant proteins isolated under native expression conditions .

  • Native-gel electrophoresis: Purified YidC and YibN formed a distinctive band when incubated together, confirming direct interaction .

The functional implications of this interaction include:

  • Enhanced biogenesis of YidC-dependent substrates (1.5-1.8 fold stimulation)

  • Correlation with increased membrane lipid synthesis and inner membrane proliferation

  • The YibN transmembrane segment is critical for interaction, as its deletion abolished complex formation

  • YibN appears to functionally augment YidC activity without being essential for cell viability

These findings position YibN as a bona fide interactor and potential modulator of YidC function, suggesting a complex regulatory network for membrane protein biogenesis .

What are the most effective methods for preparing YidC-depleted membranes for in vitro studies?

The preparation of YidC-depleted membranes requires careful methodology to ensure specific depletion without disrupting other membrane components. Based on the research literature, the following approach has proven effective:

  • Use of conditional depletion strains: Employ strains like E. coli JS7131 with arabinose-controlled YidC expression .

  • Growth conditions optimization:

    • Grow cells in LB medium with arabinose until mid-log phase

    • Harvest cells, wash thoroughly to remove arabinose

    • Resume growth in medium without arabinose for 3-4 hours

  • Quality control assessments: Verify YidC depletion while confirming integrity of other components:

    • Immunoblotting to confirm YidC absence while verifying normal levels of SecY and SecE

    • Thin layer chromatography to analyze phospholipid content, particularly PE levels

    • Measurement of membrane potential (ΔΨ) using fluorescent probes like DiBAC4 during oxidation of substrates

  • Membrane isolation and ISO vesicle preparation:

    • Disrupt cells by French press or sonication

    • Remove unbroken cells by low-speed centrifugation

    • Isolate inner membrane fraction through sucrose density gradient centrifugation

    • Prepare inside-out (ISO) vesicles by repeated passage through a narrow orifice

This approach produces YidC-depleted membranes that remain functionally comparable to control membranes in terms of phospholipid composition and maintain most of their membrane potential (approximately 10-15% reduction compared to control) , providing a reliable system for studying YidC's specific role in membrane protein biogenesis.

What in vitro systems can be used to assess YidC's role in membrane protein insertion and folding?

Several complementary in vitro systems have been developed to investigate YidC's functions:

  • Coupled transcription/translation/insertion system:

    • Components: Purified RNA polymerase, S-30 extracts, inverted membrane vesicles (INVs)

    • Detection methods: Radiolabeling with [35S]methionine, followed by protease protection assays

    • Applications: Direct comparison of insertion efficiency between YidC-containing and YidC-depleted membranes

  • Reconstituted proteoliposome system:

    • Components: Purified phospholipids, purified YidC, detergent removal by dialysis or Bio-Beads

    • Advantages: Defined composition, elimination of confounding factors

    • Applications: Direct demonstration of YidC's role by comparing systems with and without YidC

  • Translation-arrested ribosome nascent chain complexes (RNCs):

    • Components: Truncated mRNAs, ribosomes, purified YidC

    • Applications: Study of co-translational insertion and YidC-substrate interactions

  • YibN-enhanced insertion assays:

    • Components: INVs prepared from YibN-overexpressing strains

    • Detection: Quantification of membrane-protected fragments after proteinase K digestion

    • Applications: Demonstrated 1.5-1.8-fold stimulation of insertion for several YidC substrates

  • Conformational antibody binding assays:

    • Components: Monoclonal antibodies directed against conformational epitopes

    • Applications: Assessment of proper folding in different membrane preparations

    • Example: LacY was shown to bind conformational antibodies poorly in YidC-depleted membranes

These systems collectively provide powerful tools for dissecting the specific contributions of YidC to both the insertion and folding phases of membrane protein biogenesis.

How can researchers reconcile conflicting data regarding YidC dependence for different membrane proteins?

Resolving contradictory findings about YidC dependence requires systematic analysis of multiple variables:

  • Standardize depletion conditions: Different studies may achieve varying levels of YidC depletion, leading to conflicting results. Researchers should:

    • Quantify remaining YidC levels by immunoblotting

    • Use multiple time points of depletion

    • Consider conditional knockout systems versus siRNA approaches

  • Distinguish between insertion and folding effects: Many contradictions arise from failing to separate these distinct processes:

    • Employ both insertion assays (protease protection) and folding assays (conformational antibodies, functional tests)

    • Compare results with those from known YidC-dependent and YidC-independent substrates

  • Consider substrate-specific factors:

    • Analyze transmembrane domain hydrophobicity (as seen with SecG I20E mutation showing reduced YidC/YibN dependence)

    • Evaluate topology complexity (single-pass vs. multi-pass proteins)

    • Assess charge distribution in transmembrane segments

  • Evaluate experimental context differences:

    • In vivo versus in vitro experiments may yield different results

    • Cell-free systems may lack important auxiliary factors

    • Membrane lipid composition differences can influence results

  • Develop comprehensive models: Propose models that accommodate seemingly contradictory data by considering:

    • Substrate-specific pathways

    • Redundant insertion mechanisms

    • Cooperative functions between YidC and the Sec translocon

By systematically addressing these factors, researchers can develop more nuanced models of YidC function that explain apparent contradictions in experimental data.

What techniques can identify novel YidC-interacting proteins beyond established methods?

Identification of novel YidC-interacting proteins requires innovative approaches beyond traditional techniques:

  • Advanced proximity labeling methods:

    • BioID has successfully identified YibN as a YidC interactor

    • APEX2 (engineered ascorbate peroxidase) offers higher spatial and temporal resolution

    • Split-BioID allows study of transient interactions at specific cellular locations

  • Crosslinking mass spectrometry (XL-MS):

    • Apply photoreactive or chemical crosslinkers followed by mass spectrometry

    • Enables capture of transient interactions during the dynamic insertion process

    • Can provide structural information about interaction interfaces

  • Genetic interaction mapping:

    • Synthetic genetic array (SGA) analysis to identify genetic interactions

    • CRISPR interference (CRISPRi) screens to identify genes with functional relationships to YidC

    • Suppressor screens to identify proteins that can compensate for YidC deficiency

  • Cryo-electron microscopy (cryo-EM):

    • Visualize YidC-containing complexes at near-atomic resolution

    • Identify structural features that mediate protein interactions

    • Capture different states during the insertion/folding process

  • Single-molecule approaches:

    • Fluorescence resonance energy transfer (FRET) to monitor dynamic interactions

    • Optical tweezers to study forces involved in membrane protein insertion

    • Total internal reflection fluorescence (TIRF) microscopy to visualize interactions in real time

  • Computational prediction methods:

    • Machine learning algorithms trained on known YidC interactions

    • Molecular dynamics simulations to predict potential interaction partners

    • Evolution-based approaches leveraging co-evolution patterns

These advanced techniques, particularly when used in combination, can reveal the complex network of interactions surrounding YidC and provide new insights into the membrane protein biogenesis pathway.

How might YidC function differ between model organisms and Polynucleobacter species?

Investigation of species-specific YidC function requires comparative analysis across different bacterial systems:

  • Sequence and structural comparison:

    • Perform multiple sequence alignments of YidC from E. coli, Polynucleobacter, and other species

    • Identify conserved domains versus variable regions that might confer species-specific functions

    • Apply structural modeling to predict functional differences

  • Complementation studies:

    • Test whether Polynucleobacter YidC can complement E. coli YidC depletion

    • Examine substrate specificity differences through heterologous expression systems

    • Create chimeric proteins to identify domains responsible for functional differences

  • Habitat-specific adaptations:

    • Consider the ecological niche of Polynucleobacter species (freshwater environments) compared to E. coli

    • Investigate temperature optima differences that might influence membrane protein folding

    • Examine lipid composition variations that could affect YidC function

  • Interaction partner conservation:

    • Determine whether YibN homologs exist in Polynucleobacter species

    • Compare the interaction networks across species using comparative proteomics

    • Identify species-specific auxiliary factors

Methodological approaches should include:

  • Heterologous expression systems

  • Cross-species complementation assays

  • Comparative genomics and proteomics

  • In vitro reconstitution with species-specific components

What are the implications of the YidC-YibN interaction for optimizing recombinant membrane protein production?

The discovery of the YidC-YibN interaction offers promising approaches for enhancing recombinant membrane protein production:

  • Co-expression strategies:

    • Design expression vectors for simultaneous production of target proteins with YidC and YibN

    • Optimize expression ratios through titratable promoter systems

    • Create fusion constructs that bring YidC/YibN functionality in proximity to recombinant targets

  • Strain engineering approaches:

    • Develop E. coli strains with optimized YidC/YibN levels

    • Integrate additional copies of these genes into expression hosts

    • Fine-tune expression through genomic modifications

  • Substrate-specific optimization:

    • Test effectiveness for different classes of membrane proteins

    • Assess transmembrane segment hydrophobicity as a predictor of YidC/YibN enhancement

    • Apply findings from SecG I20E mutation studies to guide rational design of expression constructs

  • Membrane engineering:

    • Leverage YibN's association with increased membrane lipid synthesis and proliferation

    • Optimize membrane composition based on target protein requirements

    • Create customized membrane environments for specific recombinant proteins

Potential applications include:

  • Enhanced production of difficult membrane proteins for structural studies

  • Improved yields of membrane protein-based biocatalysts

  • Development of more effective membrane protein display technologies

These strategies could significantly advance recombinant membrane protein production for both research and biotechnological applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.