Recombinant Polynucleobacter sp. Potassium-transporting ATPase C chain (kdpC)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its implementation.
Synonyms
kdpC; Pnuc_1668; Potassium-transporting ATPase KdpC subunit; ATP phosphohydrolase [potassium-transporting] C chain; Potassium-binding and translocating subunit C; Potassium-translocating ATPase C chain
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Polynucleobacter asymbioticus (strain DSM 18221 / CIP 109841 / QLW-P1DMWA-1) (Polynucleobacter necessarius subsp. asymbioticus)
Target Names
kdpC
Target Protein Sequence
MKSIMRSCLGLFVLLTVITGVLYPVFVTGLAKTFFPSKASGSIVYQGDQAIGSELIGQNF TDAKYFWGRPSATGPQPYNGTASGGSNQGPLNPALVDAVKGRIEALQNADSTNQLPIPMD LVTASASGLDPEISPQAAQYQASRVAKARKMSLDNVNQLIAANTQDRQWGIFGEPRVNVL KLNLALDGN
Uniprot No.

Target Background

Function

The Recombinant Polynucleobacter sp. Potassium-transporting ATPase C chain (KdpC) is a component of the high-affinity ATP-driven potassium transport (Kdp) system. It catalyzes ATP hydrolysis, coupled with the electrogenic transport of potassium ions into the cytoplasm. KdpC acts as a catalytic chaperone, enhancing the ATP-binding affinity of the ATP-hydrolyzing subunit KdpB through the formation of a transient KdpB/KdpC/ATP ternary complex.

Database Links
Protein Families
KdpC family
Subcellular Location
Cell inner membrane; Single-pass membrane protein.

Q&A

What is the functional role of KdpC in the KdpFABC complex of Polynucleobacter species?

KdpC functions as an auxiliary subunit in the KdpFABC complex, which is a high-affinity K+ uptake system found in Polynucleobacter species. While KdpA serves as a channel-like subunit and KdpB acts as a P-type ATPase, KdpC has been suggested to influence substrate affinity for potassium ions . The exact mechanism by which KdpC affects the function of the complex remains not fully elucidated, but structural analyses indicate it may be involved in stabilizing the complex configuration and potentially influencing the periplasmically oriented external gate mechanism . Unlike KdpF, which is a single transmembrane helix that primarily stabilizes the complex, KdpC plays a more nuanced role in the functional dynamics of potassium transport, particularly in freshwater environments where Polynucleobacter species typically inhabit acidic conditions with low potassium concentrations .

How is genomic context of kdpC organized in Polynucleobacter species compared to other bacterial genera?

The genome organization comparison between free-living Polynucleobacter species and endosymbionts shows interesting differences:

Species/StrainGenome Size (Mbp)GC Content (%)kdpC PresenceGenomic Context
P. sphagniphilus MWH-Weng1-1ᵀ2.0445.6PresentPart of the kdpFABC operon
Polynucleobacter sp. KF0221.8745.5PresentPart of the kdpFABC operon
Polynucleobacter sp. KF0231.9845.5PresentPart of the kdpFABC operon
Polynucleobacter sp. KF0321.9345.6PresentPart of the kdpFABC operon
P. necessarius (endosymbiont)Reduced~45VariableOften modified or absent

Unlike some other bacterial genera where kdp genes may be scattered or have additional regulatory elements, Polynucleobacter species maintain a compact organization reflective of their genome-reduced lifestyle, which is common in both free-living and endosymbiotic strains of this genus .

What expression systems are most effective for producing recombinant Polynucleobacter KdpC protein?

Based on experimental approaches used for similar membrane-associated proteins, the following expression systems have proven effective for recombinant Polynucleobacter KdpC production:

E. coli-based expression systems:

  • BL21(DE3) strains have been successfully used for expressing components of the KdpFABC complex

  • The use of E. coli C41(DE3) or C43(DE3) strains, which are engineered for membrane protein expression, can improve yields for membrane-associated proteins like KdpC

Expression optimization should follow a factorial design approach with multiple variables as described in the literature . Key parameters to consider include:

ParameterOptimal RangeNotes
Temperature16-25°CLower temperatures reduce inclusion body formation
Inducer concentration0.1-0.5 mM IPTGLower IPTG concentrations often improve solubility
Media compositionNSY or modified M9Media enriched with specific ions can improve folding
Induction time4-6 hoursLonger times may reduce productivity
Cell density at inductionOD600 of 0.6-0.8Critical for optimal expression levels

When designing expression constructs, including a cleavable affinity tag (His6 or Strep-tag II) facilitates purification while allowing tag removal for functional studies. The multivariant analysis approach, where multiple parameters are evaluated simultaneously, has proven more efficient than traditional univariant methods for optimizing recombinant protein expression .

What are the characteristics of Polynucleobacter species that influence KdpC function?

Polynucleobacter species exhibit several distinctive characteristics that potentially influence KdpC function:

  • Habitat specificity: Many Polynucleobacter species inhabit acidic freshwater environments with low potassium concentrations. For example, P. sphagniphilus was isolated from bog waters with pH 4.0, creating selective pressure for high-affinity potassium uptake systems .

  • Genome reduction: Both free-living and endosymbiotic Polynucleobacter species show genome reduction (1.5-2.5 Mbp), which affects their metabolic capabilities and ion transport systems .

  • Growth parameters: Polynucleobacter strains typically grow at temperatures between 5-35°C and tolerate low salt concentrations (0-0.5% NaCl), conditions that would influence membrane fluidity and consequently affect integral membrane proteins like KdpC .

  • Fatty acid composition: The major fatty acids in Polynucleobacter species include C16:1 ω7c, C16:0, and C18:1 ω7c, which create a specific membrane environment that can affect the conformational stability and function of membrane proteins like KdpC .

  • Adaptation to low pH: Polynucleobacter species from acidic habitats possess genes for Fe(II) transporters rather than Fe(III) transporters, indicating adaptations to acidic environments that may extend to their potassium transport systems .

These characteristics create a specific physiological context that must be considered when studying or expressing recombinant KdpC from these organisms.

What experimental approaches can effectively characterize the interaction between KdpC and other subunits of the KdpFABC complex?

Several sophisticated experimental approaches can be employed to characterize KdpC interactions within the KdpFABC complex:

Structural Approaches:

  • Cryo-electron microscopy (cryo-EM): Has successfully resolved structures of KdpFABC complexes in different conformational states, allowing visualization of the intersubunit tunnel and ion binding sites. This approach can reveal KdpC's position and contacts with other subunits .

  • X-ray crystallography: Complementary to cryo-EM, providing higher resolution details of specific interactions.

  • Cross-linking coupled with mass spectrometry: Identifies specific residues involved in subunit interactions.

Functional Approaches:

  • Site-directed mutagenesis: Key residues in KdpC predicted to interact with other subunits can be mutated, followed by functional assays to determine the impact on potassium transport.

  • ATPase activity assays: Using the Phosphate Sensor system to measure ATPase activity in wild-type versus KdpC-modified complexes .

  • Isothermal titration calorimetry (ITC): Quantifies binding affinities between KdpC and other subunits.

Computational Approaches:

  • Molecular dynamics (MD) simulations: Can model the dynamics of ion coordination and translocation through the complex, elucidating KdpC's influence on this process .

  • Homology modeling: Particularly useful when direct structural data is limited.

A comprehensive research strategy would integrate these approaches, as exemplified in the study of KdpFABC where cryo-EM structures were combined with biochemical assays and MD simulations to identify key residues involved in ATPase coupling and ion propagation .

How can multi-variant experimental design optimize recombinant Polynucleobacter KdpC expression and functional analysis?

Implementing a robust multi-variant experimental design is crucial for optimizing recombinant KdpC expression and functional studies. Based on documented approaches for similar proteins , the following framework is recommended:

Fractional Factorial Design:

  • Use a 2^(k-p) fractional factorial design where k represents the number of variables and p the fraction of the complete factorial

  • For KdpC expression, eight critical variables would include: temperature, inducer concentration, media composition, pH, cell density at induction, induction time, strain selection, and codon optimization

Example of 2^(8-4) Design Matrix for KdpC Expression:

Exp.Temp (°C)IPTG (mM)MediapHOD600Time (h)StrainCodon Opt.Response (mg/L)
1160.1NSY6.50.64BL21(DE3)Nox₁
2250.1NSY7.50.68C41(DE3)Yesx₂
3160.5NSY7.51.04C41(DE3)Yesx₃
..............................
16250.5M97.51.08BL21(DE3)Nox₁₆

Analysis and Optimization:

  • Calculate main effects and interactions using the formula: Effect = (Σresponse at high level - Σresponse at low level)/n

  • Identify statistically significant variables (p < 0.05) and interactions

  • Use response surface methodology (RSM) to determine optimal conditions

  • Validate optimized conditions with triplicate experiments

Functional Analysis Design:

  • Implement similar multi-variant approaches for functional assays

  • Include controls for non-specific effects (e.g., buffer components, detergents)

  • Use mathematical models to integrate expression and functional data

This approach has successfully increased soluble expression of challenging proteins to levels exceeding 250 mg/L , and can be adapted specifically for membrane-associated proteins like KdpC by including additional variables related to membrane protein folding and stability.

What are the key structural features of KdpC that influence potassium transport in Polynucleobacter species?

While specific structural data for Polynucleobacter KdpC is limited in the provided search results, insights can be drawn from related KdpFABC complexes to identify key structural features:

Interdomain Interactions:

  • KdpC likely interacts with both KdpA and KdpB to stabilize the complex architecture

  • These interactions may influence the conformation of the intersubunit tunnel through which K+ ions are transported

Regulatory Domains:

  • Specific regions of KdpC may respond to environmental signals (such as acidic pH common in Polynucleobacter habitats)

  • These domains could alter conformation in response to changes in external potassium concentration

Functional Motifs:
The following motifs are likely present in Polynucleobacter KdpC based on homology with characterized KdpC proteins:

MotifPositionProposed Function
N-terminal domain~1-100Membrane association
Central domain~100-200Interaction with KdpA
C-terminal domain~200-300Interaction with KdpB
Periplasmically oriented regionVariableMay function as external gate

Species-Specific Adaptations:

  • Polynucleobacter species from acidic environments (pH 4.0-5.5) likely possess KdpC variants with structural adaptations for function in low pH

  • These adaptations may include altered surface charge distribution and modified ion-coordinating residues

  • Gene content similarity among Polynucleobacter strains from acidic environments suggests common adaptations in their potassium transport systems

Understanding these structural features requires integrated approaches combining structural biology, mutagenesis, and functional assays, particularly focusing on species-specific adaptations related to the diverse ecological niches of different Polynucleobacter species .

How do horizontal gene transfer events influence the evolution of kdpC in Polynucleobacter species?

Horizontal gene transfer (HGT) plays a significant role in the evolution of Polynucleobacter species, including their kdpC genes. Evidence from genomic analyses suggests several important patterns:

Genomic Islands (GIs) Acquisition:

  • Microdiversification in Polynucleobacter species is significantly influenced by horizontal acquisition of accessory genomic islands

  • These GIs can be transferred across species boundaries, even between Polynucleobacter strains with average nucleotide identity (ANI) values of only ~80%

Transfer Mechanisms:

  • Some GIs in Polynucleobacter appear to be transferred by integrases (e.g., integrase/recombinase XerD)

  • While tRNAs often flank horizontally transferred regions in many bacteria, this pattern was not consistently observed in Polynucleobacter GIs

Functional Consequences for kdpC:

  • HGT events can introduce novel functionalities to kdpC, potentially facilitating adaptation to different ecological niches

  • For example, strains inhabiting similar acidic habitats show higher similarity in gene content despite geographic distance, suggesting horizontal transfer of adaptive traits

Evolutionary Patterns:

  • Phylogeographic separation related to climatic division has been observed in Polynucleobacter PnecC subclusters

  • The acquisition of specific kdpC variants may contribute to adaptation to local conditions

Evidence from Comparative Genomics:

These HGT events create a complex evolutionary landscape for kdpC genes in Polynucleobacter, likely contributing to the remarkable ecological diversification of this genus across freshwater habitats worldwide .

What methodological approaches can identify structure-function relationships in Polynucleobacter KdpC proteins?

Elucidating structure-function relationships in Polynucleobacter KdpC requires an integrated methodology combining molecular, biophysical, and computational approaches:

Genetic Engineering Approaches:

  • Alanine scanning mutagenesis: Systematically replace conserved residues with alanine to identify functionally important amino acids

  • Domain swapping: Exchange domains between KdpC proteins from different Polynucleobacter species adapted to different pH environments to identify regions responsible for pH-specific function

  • Chimeric protein construction: Create fusion proteins between KdpC and fluorescent tags for localization and FRET studies

Structural Analysis:

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Maps protein dynamics and solvent accessibility, particularly useful for membrane proteins

  • Small-angle X-ray scattering (SAXS): Provides low-resolution structural information in solution

  • Solid-state NMR: Can provide structural information on membrane-embedded regions

Functional Assays:

  • Potassium uptake assays: Measure 86Rb+ uptake in cells expressing wild-type versus mutant KdpC

  • ATPase activity measurements: Use the Phosphate Sensor system to quantify ATP hydrolysis rates

  • Electrophysiological techniques: Apply patch-clamp or solid-supported membrane techniques to measure ion currents

Computational Methods:

  • Molecular dynamics simulations: Model the effects of mutations on protein dynamics and ion transport

  • Sequence coevolution analysis: Identify co-evolving residues that may form functional networks

  • Machine learning approaches: Predict functional effects of mutations based on multiple sequence alignments

Data Integration:

  • Correlate structural features with habitat parameters (e.g., pH, ion concentrations)

  • Map conservation patterns onto structural models to identify functionally important regions

  • Apply statistical coupling analysis to identify networks of co-evolving amino acids

This multifaceted approach would be particularly valuable for understanding how Polynucleobacter species from different acidic environments (e.g., bog ponds versus humic lakes) have adapted their KdpC proteins to specific ecological niches .

How do environmental factors influence kdpC expression and KdpC function in different Polynucleobacter species?

Environmental factors significantly shape kdpC expression and KdpC function in Polynucleobacter species, reflecting their adaptation to diverse freshwater habitats:

pH Adaptation:

  • Canonical correspondence analysis (CCA) of Polynucleobacter communities shows pH is a major driver of community composition

  • Strains from acidic habitats (pH 4.0-5.5) possess genomic adaptations such as Fe(II) transporters rather than Fe(III) transporters, suggesting parallel adaptations in potassium transport systems

  • The expression of kdpC is likely regulated differently in strains from acidic versus neutral habitats

Calcium Concentration Effects:

  • Low calcium environments show distinct patterns of Polynucleobacter community composition

  • This may reflect differing regulation of ion transport systems, including kdpC expression

Habitat-Specific Expression Patterns:

Habitat TypeTypical pHCa²⁺ ConcentrationObserved KdpC Expression Pattern
Bog ponds3.5-5.0Very lowConstitutive expression likely
Humic lakes5.0-6.5LowRegulated by K⁺ availability
Eutrophic lakes6.5-9.0Moderate to highHighly regulated expression

Molecular Basis of Environmental Adaptation:

  • Polynucleobacter species from similar habitats show higher similarity in gene content despite geographic distance

  • This suggests convergent evolution or horizontal gene transfer of adaptive traits

  • KdpC proteins from strains inhabiting acidic environments may have modifications in ion-coordinating residues to function optimally at low pH

Experimental Evidence:

  • Cultivation-independent investigations detected Polynucleobacter strains with high abundance specifically in acidic systems but not in alkaline waters

  • Habitats where certain Polynucleobacter taxa are abundant typically feature Sphagnum moss, creating distinct chemical conditions that likely influence kdpC regulation

Regulatory Mechanisms:

  • The σ-factor responsible for kdpC transcription may differ between Polynucleobacter strains from different habitats

  • Two-component regulatory systems likely control kdpC expression in response to environmental potassium levels

Understanding these environmental influences is crucial for interpreting functional data and designing relevant experimental conditions when working with recombinant KdpC from different Polynucleobacter species .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.