Recombinant Polyodon spathula Cytochrome c oxidase subunit 1 (mt-co1)

Shipped with Ice Packs
In Stock
Cat. No.
BT2059286
Source
in vitro E.coli expression system
Synonyms
mt-co1; coi; coxi; mtco1; Cytochrome c oxidase subunit 1; Cytochrome c oxidase polypeptide I; Fragment
Quick Inquiry

Description

Recombinant mt-co1 Production

Recombinant mt-co1 proteins are typically expressed in E. coli with affinity tags for purification. For example:

Role in Mitochondrial Translation

  • Mss51p interaction: In yeast, Mss51p stabilizes newly synthesized Cox1p (mt-co1 homolog) and coordinates its insertion into the inner mitochondrial membrane .

  • Translational regulation: Mutations in COX1 mRNA 5′-UTRs disrupt Mss51p-dependent translation, highlighting conserved regulatory mechanisms .

Disease Associations

  • Human pathologies: MT-CO1 mutations are linked to Leber’s hereditary optic neuropathy (LHON), Complex IV deficiency, and sensorineural deafness .

  • Functional assays: Anti-MTCO1 antibodies (e.g., ab14705) enable detection in Western blot, immunohistochemistry, and flow cytometry .

Evolutionary Insights

  • DNA barcoding: MT-CO1’s conserved sequence and mutation rate make it a standard marker for animal species identification .

  • Comparative genomics: Sturgeons and paddlefish (Polyodon spathula) exhibit lineage-specific whole-genome duplication events, influencing mitochondrial gene evolution .

Challenges and Future Directions

  • Species-specific gaps: No direct studies on recombinant Polyodon spathula mt-co1 exist, necessitating extrapolation from model organisms like Polypterus or yeast .

  • Functional studies: Structural resolution of the BNC and proton-pumping mechanisms remains a priority for drug targeting in mitochondrial disorders .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will fulfill it to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery times, please contact your local distributor.
Note: Our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on multiple factors including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type requirement, please inform us and we will prioritize its implementation.
Synonyms
mt-co1; coi; coxi; mtco1; Cytochrome c oxidase subunit 1; Cytochrome c oxidase polypeptide I; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Polyodon spathula (North American paddlefish) (Squalus spathula)
Target Names
mt-co1
Target Protein Sequence
HLFWFFGHPEVYILILPGFGMISHIVAYYAGKKEPFGYMGMVWAMMAIGLLGFIVWAHHM FTVGMDVDTRAYFTSATMIIAIPTGVKVFSWLATLHGGSIKWDTPLLWALGFIFLFTVGG LTGIVLANSSLDIVLHDTYYVVAHFHYVLSMGAVFAIM
Uniprot No.
P29650

Target Background

Function
Cytochrome c oxidase subunit 1 (mt-co1) is a component of cytochrome c oxidase, the final enzyme in the mitochondrial electron transport chain that drives oxidative phosphorylation. The respiratory chain consists of three multisubunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (cytochrome b-c1 complex, complex III, CIII), and cytochrome c oxidase (complex IV, CIV). These complexes work together to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner membrane that powers transmembrane transport and the ATP synthase. Cytochrome c oxidase is responsible for catalyzing the reduction of oxygen to water. Electrons originating from reduced cytochrome c in the intermembrane space (IMS) are transferred through the dinuclear copper A center (CU(A)) of subunit 2 and heme A of subunit 1 to the active site in subunit 1. This active site, known as the binuclear center (BNC), is formed by heme A3 and copper B (CU(B)). The BNC reduces molecular oxygen to 2 water molecules using 4 electrons from cytochrome c in the IMS and 4 protons from the mitochondrial matrix.
Protein Families
Heme-copper respiratory oxidase family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.