Recombinant Polypeptide N-acetylgalactosaminyltransferase 3 (gly-3)

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Recombinant gly-3 is produced in E. coli expression systems, typically fused with an N-terminal His tag for purification. Key structural and functional features include:

Key Features

  • Amino Acid Sequence: Comprises 612 residues in Caenorhabditis elegans (UniProt ID: P34678), with catalytic and lectin domains critical for substrate recognition and binding .

  • Domains:

    • Catalytic Domain: Mediates GalNAc transfer from UDP-GalNAc to peptide substrates.

    • Lectin Domain: Facilitates carbohydrate binding, enhancing substrate specificity .

  • Purity: >90% as confirmed by SDS-PAGE .

Table 1: Recombinant gly-3 Production Details

ParameterSpecification
Host SystemE. coli
TagN-terminal His
Protein LengthFull-length (1-612 aa)
StorageLyophilized, -20°C/-80°C
ReconstitutionTris/PBS buffer, 6% trehalose, pH 8.0

Enzymatic Activity and Assays

Gly-3 activity is quantified using phosphatase-coupled assays with synthetic peptides like EA2 (AnaSpec Inc) and UDP-GalNAc as substrates .

Optimal Reaction Conditions

  • Substrates:

    • EA2 peptide: 0.25 mM final concentration .

    • UDP-GalNAc: 0.5 mM .

  • Cofactors: Requires Mn²⁺ or Ca²⁺ for activation .

  • Temperature: Maximal activity at 20–25°C, sharply declines above 30°C .

Table 2: Activity Across Substrates

Peptide SubstrateSequenceRelative Activity (%)
S. mansoni mucinISTSPSPSNITTTT100
Human MUC1DTRPAPGSTA18
Human MUC2PTTTPITTTTTV18

Data adapted from phosphatase-coupled assays .

Cancer Prognosis

  • Gastric Carcinoma: Strong gly-3 expression correlates with differentiated tumor histology (64.4% in differentiated vs. 36.2% in undifferentiated tumors) and improved 5-year survival (71.0% vs. 49.3% in low expressors) .

  • Colorectal Cancer: Overexpression linked to tumor differentiation and reduced metastasis.

Metabolic Disorders

  • Tumoral Calcinosis: Loss-of-function mutations cause hyperphosphatemia and ectopic calcifications .

Glycosylation Studies

  • Hierarchical Glycosylation: Gly-3 acts as an "intermediate transferase," modifying mucin domains after initial GalNAc addition by early transferases .

Industrial and Research Use

  • Tool for O-Glycosylation Studies: Used to probe site-specific glycosylation patterns in mucins and other glycoproteins .

  • Recombinant Production: Scalable in E. coli, with yields >90% purity .

Challenges and Future Directions

  • Isoform Redundancy: Overlapping activities with other GALNTs complicate functional studies .

  • Therapeutic Potential: Targeting gly-3 could modulate mucin-mediated pathways in cancer or metabolic diseases .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will prepare according to your needs.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it accordingly.
Synonyms
gly-3; ZK688.8; Polypeptide N-acetylgalactosaminyltransferase 3; GalNAc-T1; Protein-UDP acetylgalactosaminyltransferase 3; UDP-GalNAc:polypeptide N-acetylgalactosaminyltransferase 3; pp-GaNTase 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-612
Protein Length
full length protein
Species
Caenorhabditis elegans
Target Names
gly-3
Target Protein Sequence
MLSVGGGRSAVCRAVIATSIVWLLIDVVILFYYLDPSTSQQQPFPEDNRILNRARRIEPLPPAAQHDSDPDAHPIQPEKQEKQVYPVDKETANQLRKLMETQAFGPGYHGQGGTGVTVPEDKKTIKEKRFLENQFNVVASEMISVNRTLPDYRSDACRTSGNNLKTAGMPKTSIIIVFHNEAWTTLLRTLHSVINRSPRHLLEEIILVDDKSDRDYLVKPLDSYIKMFPIPIHLVHLENRSGLIRARLTGSEMAKGKILLFLDAHVEVTDGWLEPLVSRVAEDRKRVVAPIIDVISDDTFEYVTASETTWGGFNWHLNFRWYAVPKRELNRRGSDRSMPIQTPTIAGGLFAIDKQFFYDIGSYDEGMQVWGGENLEISFRVWMCGGSLEIHPCSRVGHVFRKQTPYTFPGGTAKVIHHNAARTAEVWMDEYKAFFYKMVPAARNVEAGDVSERKKLRETLQCKSFKWYLENIYPEAPLPADFRSLGAIVNRFTEKCVDTNGKKDGQAPGIQACHGAGGNQAWSLTGKGEIRSDDLCLSSGHVYQIGSELKLERCSVSKINVKHVFVFDDQAGTLLHKKTGKCVTGADQRVTLDECGLGRKDQMWQLEGYQSP
Uniprot No.

Target Background

Function
Catalyzes the initial reaction in O-linked oligosaccharide biosynthesis. This involves transferring an N-acetyl-D-galactosamine residue to a serine or threonine residue on the protein receptor.
Database Links

KEGG: cel:CELE_ZK688.8

STRING: 6239.ZK688.8.1

UniGene: Cel.17588

Protein Families
Glycosyltransferase 2 family, GalNAc-T subfamily
Subcellular Location
Golgi apparatus membrane; Single-pass type II membrane protein.

Q&A

What is the structural organization of GALNT3 and how does it relate to its function?

GALNT3 (Polypeptide N-acetylgalactosaminyltransferase 3) is structurally characterized by an N-terminal catalytic domain tethered by a short linker to a C-terminal ricin-like lectin domain containing three potential carbohydrate-binding sites . This organization is essential for its function as a glycosyltransferase that catalyzes the initial step of O-glycosylation by transferring GalNAc to threonine or serine residues in target proteins, resulting in GalNAc alpha 1-O-Ser/Thr linkages . The catalytic domain contains the active site for the glycosyl transfer reaction, while the lectin domain assists in substrate recognition and binding specificity. This dual-domain architecture facilitates GALNT3's role as an intermediate transferase that increases the density of O-linked glycans within mucin domains following initial glycosylation by early transferases .

Where is GALNT3 primarily expressed in normal human tissues?

Unlike some other GALNT family members that show broad tissue distribution, GALNT3 expression appears to be highly regulated and is predominantly found in pancreatic and testicular tissues . This restricted expression pattern suggests tissue-specific roles for GALNT3-mediated glycosylation. The subcellular localization of GALNT3 is primarily within the Golgi apparatus compartment, consistent with its function in post-translational modification of proteins during their processing through the secretory pathway . Immunofluorescence studies using anti-GALNT3 antibodies have demonstrated specific staining localized to Golgi granules in human cell lines such as HeLa cervical epithelial carcinoma cells .

How does GALNT3 contribute to the hierarchical process of O-glycosylation?

GALNT3 functions within a complex glycosylation machinery consisting of 20 distinct GALNT isoforms in humans, each with partially overlapping but unique substrate specificities . As an intermediate transferase, GALNT3 typically acts after the initial glycosylation steps performed by early transferases . This hierarchical action is particularly important in the glycosylation of mucins, which results from the successive and coordinated action of several specific GALNTs . GALNT3 increases the density of O-linked glycans within the mucin domain, contributing to the complex glycosylation patterns observed in heavily glycosylated proteins . Unlike many enzymes, GALNTs including GALNT3 do not recognize a universal consensus glycosylation sequence, making prediction of specific glycosylation sites challenging .

How does GALNT3 expression correlate with cancer progression in different tumor types?

GALNT3 expression patterns show tumor-type specific correlations with cancer progression and patient outcomes. In pancreatic ductal adenocarcinoma (PDAC), GALNT3 expression is significantly decreased in poorly differentiated tumors compared to well/moderately differentiated PDAC . This downregulation appears to be associated with increased tumor aggressiveness and altered glycosylation of ErbB family proteins . Conversely, in epithelial ovarian cancer (EOC), GALNT3 is hypomethylated and strongly overexpressed in high-grade serous tumors compared to normal ovarian tissues . This overexpression significantly correlates with shorter progression-free survival intervals in EOC patients with advanced disease . These contrasting patterns suggest that GALNT3's role in cancer progression is context-dependent and may involve tissue-specific mechanisms affecting different downstream targets.

What molecular mechanisms underlie GALNT3's influence on cancer cell behavior?

GALNT3 affects cancer cell behavior through multiple molecular mechanisms:

  • Altered receptor tyrosine kinase glycosylation: In PDAC, knockdown of GALNT3 results in altered O-glycans (Tn and T antigens) on EGFR and Her2, which is accompanied by increased phosphorylation of these receptors . This suggests that GALNT3-mediated glycosylation may regulate receptor activation and downstream signaling.

  • Cell proliferation and colony formation: Studies in ovarian cancer cells demonstrate that GALNT3 gene knockdown leads to a sharp decrease in viable adherent cells and significantly lower numbers of colonies formed compared to control cells . This indicates GALNT3's influence on cancer cell proliferation and clonogenic potential.

  • Cell cycle regulation: GALNT3 knockdown in ovarian cancer cells results in significant accumulation of cells in the S phase after hydroxyurea removal, suggesting that GALNT3 affects cell cycle progression .

  • Migration and invasion: Experimental evidence indicates that GALNT3 influences cancer cell motility and invasive capacity, which are key determinants of metastatic potential .

What is the significance of GALNT3 dysregulation in the context of abnormal mucin O-glycosylation in cancer?

Aberrant mucin-type O-glycosylation is a hallmark of many epithelial cancers and contributes to altered cell adhesion, immune evasion, and metastatic potential . GALNT3 dysregulation represents a potential mechanism underlying these glycosylation changes:

  • In PDAC, loss of GALNT3 is associated with altered glycosylation of key proteins including members of the ErbB family (EGFR and Her2) . These changes may contribute to increased receptor activation and downstream signaling promoting tumor growth and survival.

  • In ovarian cancer, hypomethylation and overexpression of GALNT3 correlate with disease aggressiveness, suggesting that increased GALNT3-mediated glycosylation may promote malignancy in this context .

  • The tissue-specific effects of GALNT3 dysregulation highlight the complex relationship between glycosyltransferase expression, glycan structures, and cellular phenotypes in different cancer types.

These findings suggest that GALNT3 could serve as both a biomarker and potential therapeutic target, though its contrasting roles in different cancer types necessitate careful context-specific approaches.

What are the optimal approaches for studying GALNT3 enzymatic activity in vitro?

The Transcreener GALNT3 assay represents a robust methodology for measuring GALNT3 enzymatic activity in vitro . This approach:

  • Measures reaction product directly: The assay determines GALNT3 activity by directly measuring UDP formed by the enzyme using antibodies selective to UDP over UDP-sugar donors coupled with a far-red fluorescent tracer .

  • Offers multiple detection modalities: The assay is available with fluorescence polarization (FP), fluorescence intensity (FI), and time-resolved fluorescence resonance energy transfer (TR-FRET) detection methods, providing flexibility for different instrumentation platforms .

  • Features simple workflow: The GALNT3 assay employs a straightforward mix-and-read format where researchers perform the enzyme reaction, add the detection reagent, and measure the signal .

  • Supports high-throughput screening: The assay is compatible with 96, 384, and 1536-well formats, making it suitable for large-scale compound screening efforts .

  • Provides robust data quality: Z' measurements using optimized GALNT3 reaction conditions indicate excellent assay robustness with Z' values >0.85 at 10% conversion, demonstrating good sensitivity under initial velocity conditions .

The lower limit of detection for this assay is approximately 100 nM UDP, with a linear correlation under initial velocity conditions when GALNT3 is titrated in the presence of appropriate substrates such as Mucin 10-EA2 peptide (10 μM) and UDP-GalNAc (10 μM) .

What experimental controls should be included when investigating GALNT3 function through gene knockdown?

When designing GALNT3 knockdown experiments, the following controls are essential:

  • Non-targeting shRNA/siRNA control: To account for non-specific effects of the RNA interference machinery and transfection/transduction procedures .

  • Rescue experiments: Re-expression of GALNT3 in knockdown cells to confirm phenotype specificity.

  • Multiple knockdown constructs: Using at least two different shRNA/siRNA sequences targeting GALNT3 to minimize off-target effects .

  • Enzymatic activity validation: Confirmation that GALNT3 enzymatic activity is indeed reduced using methods such as the Transcreener GALNT3 assay .

  • Glycosylation status assessment: Lectin pull-down assays to verify alterations in O-glycan profiles, particularly Tn and T antigens on target proteins like EGFR and Her2 .

  • Phenotypic controls: For cell proliferation assays, include both cell index measurements and colony formation assays for comprehensive assessment of growth effects .

  • Cell cycle analysis controls: When examining cell cycle effects, include appropriate time points after synchronization (e.g., 6 and 9 hours after hydroxyurea removal) to capture dynamic changes .

What approaches can be used to identify and validate GALNT3 substrates in cancer cells?

Identification and validation of GALNT3 substrates require multi-faceted approaches:

TechniqueApplicationAdvantagesLimitations
Lectin pull-down assayDetection of altered O-glycosylation on specific proteinsCan be applied to endogenous proteins; directly assesses glycosylation changesLimited specificity for particular glycan structures
Mass spectrometryComprehensive identification of glycosylated proteins and glycosylation sitesProvides site-specific information; can be quantitativeComplex data analysis; requires specialized equipment
Immunoblotting with glycan-specific antibodiesDetection of specific glycan structures on target proteinsHigh specificity for particular glycan epitopesLimited availability of glycan-specific antibodies
In vitro glycosylation assaysDirect assessment of GALNT3 activity on candidate substratesEstablishes direct enzyme-substrate relationshipsMay not reflect in vivo complexity
CRISPR/Cas9 genomic editingGeneration of GALNT3 knockout modelsComplete elimination of GALNT3 activityMay trigger compensatory mechanisms by other GALNTs

For validation of GALNT3 substrates in cancer contexts, researchers should:

  • Compare glycosylation patterns in GALNT3-expressing versus knockdown/knockout cells

  • Perform rescue experiments with wild-type and catalytically inactive GALNT3 mutants

  • Correlate changes in substrate glycosylation with phenotypic outcomes

  • Investigate downstream signaling effects of altered glycosylation on candidate substrates

How should researchers interpret contradictory findings on GALNT3 expression in different cancer types?

The apparently contradictory findings that GALNT3 is downregulated in poorly differentiated PDAC but overexpressed in high-grade serous ovarian cancer highlight the context-dependent nature of glycosyltransferase function in cancer. When interpreting such data, researchers should consider:

  • Tissue-specific baseline expression: GALNT3 is normally expressed at different levels across tissues, with highest expression in pancreas and testis . Changes should be interpreted relative to the appropriate normal tissue control.

  • Substrate availability: Different tissues express distinct sets of proteins that may serve as GALNT3 substrates, potentially explaining differential effects of GALNT3 dysregulation.

  • Compensatory mechanisms: Other GALNT family members may compensate for GALNT3 loss or work synergistically with increased GALNT3, resulting in tissue-specific outcomes.

  • Signaling context: The downstream effects of altered glycosylation depend on the signaling networks active in each tissue type. The same glycosylation change may have different functional consequences in different cellular contexts.

  • Methodological considerations: Ensure that expression is measured at both mRNA and protein levels, as post-transcriptional regulation may affect GALNT3 protein abundance independently of gene expression.

To reconcile contradictory findings, researchers should consider comprehensive analyses that account for both GALNT3 expression and activity levels, substrate availability, and downstream functional consequences in each specific cancer context.

What statistical approaches are most appropriate for analyzing GALNT3 enzymatic activity data?

For robust analysis of GALNT3 enzymatic activity data, researchers should consider:

  • Standard curve calibration: Use a standard curve that mimics an enzyme reaction (as UDP-sugar concentration decreases, UDP concentration increases) to accurately convert signal to UDP concentration .

  • Initial velocity conditions: Ensure measurements are taken under initial velocity conditions (typically <10% substrate conversion) where the reaction rate is linear with time and enzyme concentration .

  • Z' factor calculation: For assay validation, calculate Z' values to assess assay quality. Values >0.5 indicate an excellent assay, with >0.85 being ideal for high-throughput screening applications .

  • Michaelis-Menten kinetics: Determine Km and Vmax values by varying substrate concentration while keeping enzyme concentration constant. Use non-linear regression to fit data to the Michaelis-Menten equation.

  • Inhibitor studies: For inhibitor analysis, determine IC50 values using sigmoidal dose-response curves and calculate Ki values using appropriate competitive, non-competitive, or uncompetitive inhibition models.

  • Statistical tests: Use appropriate statistical tests (t-test for two-group comparisons, ANOVA for multiple groups) with corrections for multiple comparisons (e.g., Bonferroni, Tukey's HSD) when evaluating differences in enzymatic activity.

  • Consideration of confounding factors: Account for potential sources of variation such as batch effects, reagent stability, and instrument performance in longitudinal studies.

How can researchers effectively integrate GALNT3 glycosylation data with other -omics datasets?

Integrating GALNT3 glycosylation data with other -omics datasets requires sophisticated bioinformatic approaches:

  • Correlation analysis: Perform correlation analyses between GALNT3 expression/activity and glycoproteomic data to identify putative substrates. Extend this to transcriptomic, proteomic, and phosphoproteomic datasets to uncover relationships between glycosylation and other cellular processes.

  • Pathway enrichment analysis: Identify biological pathways enriched among proteins with altered glycosylation in response to GALNT3 modulation using tools such as DAVID, GSEA, or Ingenuity Pathway Analysis.

  • Network analysis: Construct protein-protein interaction networks incorporating glycosylation data to visualize how GALNT3-mediated modifications affect cellular signaling networks.

  • Multi-omics factor analysis: Apply dimensionality reduction techniques designed for multi-omics data integration to identify latent factors driving coordinate changes across datasets.

  • Causal network modeling: Use causal inference methods to establish directional relationships between GALNT3 activity, altered glycosylation, and downstream phenotypic changes.

  • Clinical correlation: Integrate findings with clinical data (e.g., survival outcomes, treatment response) to establish clinical relevance and potential biomarker applications.

By integrating multiple data types, researchers can develop more comprehensive models of how GALNT3-mediated glycosylation influences cellular behavior in normal and disease states.

What are the optimal methods for detecting GALNT3 protein in tissue samples and cell lines?

Several methods can be employed for detecting GALNT3 protein in biological samples, each with specific advantages:

  • Western blotting: Western blot analysis using specific anti-GALNT3 antibodies can detect GALNT3 protein in cell and tissue lysates. For example, GALNT3 can be detected as a specific band at approximately 75 kDa under reducing conditions using sheep anti-human GALNT3 antibodies at concentrations of approximately 0.5 μg/mL . This technique has been successfully applied to detect GALNT3 in cancer cell lines such as COLO 205 (colorectal adenocarcinoma) and MCF-7 (breast cancer), as well as in mouse testis tissue .

  • Immunohistochemistry (IHC): IHC is useful for examining GALNT3 expression patterns in tissue sections, allowing assessment of expression levels and subcellular localization in the context of tissue architecture. This approach is particularly valuable for comparing normal and neoplastic tissues, as demonstrated in studies of pancreatic and ovarian cancer .

  • Immunofluorescence: Immunofluorescence provides high-resolution detection of GALNT3 subcellular localization. For instance, GALNT3 has been visualized in the Golgi apparatus of HeLa cells using sheep anti-human GALNT3 antibodies (15 μg/mL) followed by fluorophore-conjugated secondary antibodies .

  • Enzyme-linked immunosorbent assay (ELISA): Direct ELISAs using recombinant human GALNT3 can be employed for quantitative detection, though care must be taken to ensure antibody specificity, as some antibodies may show cross-reactivity with other GALNT family members .

What experimental approaches can effectively measure alterations in GALNT3-mediated glycosylation?

To measure changes in GALNT3-mediated glycosylation, researchers can employ:

  • Lectin pull-down assays: These assays use lectins with specificity for particular glycan structures (e.g., Tn and T antigens) to isolate glycoproteins from cell lysates, followed by immunoblotting for specific proteins of interest. This approach has been used to demonstrate altered O-glycosylation of EGFR and Her2 in GALNT3 knockdown PDAC cells .

  • Mass spectrometry-based glycoproteomics: Advanced mass spectrometry techniques can identify and quantify site-specific glycosylation changes on multiple proteins simultaneously. This approach provides comprehensive assessment of GALNT3's contribution to the cellular glycoproteome.

  • Affinity mass spectrometry (AMS): AMS is an emerging tool for studying protein-carbohydrate complexes that can be adapted to analyze GALNT3 interactions with substrates. Direct electrospray ionization mass spectrometry (ESI-MS) can be used to analyze binding data for protein-carbohydrate complexes, though this typically requires purified components .

  • Glycan-specific antibodies: Antibodies recognizing specific glycan structures (e.g., anti-Tn, anti-T antigen) can be used in immunoblotting or immunofluorescence to detect changes in these structures following GALNT3 modulation.

  • Enzymatic activity assays: The Transcreener GALNT3 assay measures UDP production as a direct readout of GALNT3 enzymatic activity, allowing quantitative assessment of how experimental manipulations affect enzyme function .

How can researchers design experiments to distinguish between GALNT3-specific effects and redundant functions of other GALNT family members?

Distinguishing GALNT3-specific effects from those of other GALNT family members requires careful experimental design:

  • Expression profiling: Comprehensive profiling of all GALNT family members (GALNT1-20) at both mRNA and protein levels in the experimental system to identify potentially redundant isoforms.

  • Sequential knockdown/knockout: Individual knockdown/knockout of GALNT3 followed by assessment of phenotypic effects, then additional knockdown of other GALNTs to identify compensatory or redundant functions.

  • Rescue experiments with isoform specificity: Rescue experiments using not only wild-type GALNT3 but also other GALNT family members to determine which phenotypic effects are GALNT3-specific versus those that can be compensated by other family members.

  • Substrate specificity analysis: In vitro enzyme assays comparing the activity of GALNT3 and other GALNTs against panels of potential substrates to identify unique versus shared targets.

  • Domain swapping experiments: Creation of chimeric proteins with domains from different GALNT family members to identify the structural determinants of substrate specificity.

  • Temporal analysis: Assessment of glycosylation changes at multiple time points following GALNT3 depletion to distinguish immediate effects (likely GALNT3-specific) from delayed changes (potentially due to compensatory mechanisms).

  • Site-specific glycosylation analysis: Mass spectrometry identification of glycosylation sites affected by GALNT3 depletion compared to sites affected by depletion of other GALNTs to establish isoform-specific modification patterns.

By combining these approaches, researchers can delineate the unique contributions of GALNT3 to cellular glycosylation patterns and phenotypes while accounting for the functional redundancy within this large enzyme family.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.