Recombinant Polypterus ornatipinnis ATP synthase subunit a (mt-atp6)

Shipped with Ice Packs
In Stock

Description

Biochemical Roles

  • Proton translocation: Subunit a forms part of the F₀ domain’s proton channel, enabling proton flow to drive ATP synthesis .

  • Complex assembly: Interacts with subunits b, c, and d to stabilize the ATP synthase holoenzyme .

Disease Associations

In humans, pathogenic MT-ATP6 variants are linked to mitochondrial disorders such as Leigh syndrome and NARP (neuropathy, ataxia, and retinitis pigmentosa) . While no direct association exists with Polypterus ornatipinnis mt-atp6, its recombinant form may serve as a model for studying ATP synthase dysfunction.

Experimental Uses

Recombinant mt-atp6 proteins are used in:

  • ELISA assays: For detecting specific antibodies or interactions .

  • Structural studies: To investigate proton translocation mechanisms via cryo-EM or X-ray crystallography .

  • Functional assays: Assessing ATP synthesis efficiency in vitro or in organelle-based systems .

Comparative Insights from Other Species

Research on ATP synthase subunit a in other organisms provides context for its potential utility in Polypterus ornatipinnis:

SpeciesKey FindingsRelevance
HumanMutations in MT-ATP6 reduce ATP synthesis and increase mitochondrial membrane potential .Highlights the protein’s role in energy production and disease pathogenesis.
YeastPathogenic MT-ATP6 variants impair ATP synthase assembly and proton pumping .Demonstrates conserved functional roles across eukaryotes.
BovineStructural studies reveal subunit a’s interaction with the c-ring and peripheral stalk .Provides a template for understanding Polypterus ornatipinnis mt-atp6’s architecture.

Challenges and Future Directions

  • Limited data: Specific studies on Polypterus ornatipinnis mt-atp6 are sparse, necessitating extrapolation from homologs .

  • Functional characterization: Further research is needed to validate its role in ATP synthesis and proton translocation.

  • Therapeutic potential: Could serve as a model for developing treatments targeting ATP synthase dysfunction in mitochondrial disorders .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please contact your local distributors for specific delivery time information.
Note: All proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
mt-atp6; atp6; atpase6; mtatp6; ATP synthase subunit a; F-ATPase protein 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Polypterus ornatipinnis (Ornate bichir)
Target Names
Target Protein Sequence
MTLSFLDQFASQSFLGIPLIAIAILIPWMLFPSPYKRWMSNRLITFQSWFIARTTNQLML PLNTGAHKWAMILTALLLFLMTLNLLGLLPYTFTPTTQLSMNMALAVPLWLATVLIGMRN QPTHSLAHLLPEGTPTPLIPILIIIETISLFIRPLALGVRLTANLTAGHLLIQLISTATF VMLSIMPTIATLTFIVLALLTILEIAVAMIQAYVLVLLLSLYLQENV
Uniprot No.

Target Background

Function
Mitochondrial membrane ATP synthase (F(1)F(0) ATP synthase or Complex V) generates ATP from ADP in the presence of a proton gradient across the membrane, which is produced by the electron transport complexes of the respiratory chain. F-type ATPases consist of two structural domains: F(1), which houses the extramembraneous catalytic core, and F(0), which contains the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. This subunit is a key component of the proton channel and may play a direct role in the translocation of protons across the membrane.
Protein Families
ATPase A chain family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the function of MT-ATP6 in mitochondrial energy production?

MT-ATP6 encodes a critical subunit of ATP synthase (Complex V), which is essential for oxidative phosphorylation. This protein forms part of the membrane-embedded F₀ portion of ATP synthase, specifically creating a channel that allows protons to flow across the inner mitochondrial membrane. This proton flow generates the energy required for the catalytic F₁ portion to convert ADP to ATP, the cell's main energy source .

The MT-ATP6-encoded subunit (subunit a) is crucial for the rotary mechanism of ATP synthase, where proton translocation drives the rotation of the c-ring, which in turn powers ATP synthesis. Without properly functioning MT-ATP6, the efficiency of oxidative phosphorylation is significantly compromised, resulting in reduced cellular energy production .

How conserved is the ATP synthase subunit a sequence across species?

The ATP synthase subunit a shows remarkable evolutionary conservation across species, particularly in functional domains. When comparing the Polypterus ornatipinnis sequence with human MT-ATP6, there are several highly conserved regions, especially around the proton channel and subunit interfaces .

Key conserved residues include:

  • Transmembrane helices that form the proton channel

  • The arginine residue critical for proton translocation

  • Interface regions that interact with the c-ring

This high degree of conservation makes Polypterus ornatipinnis a suitable model for studying MT-ATP6 function and provides justification for using its recombinant protein in research applications .

How can recombinant Polypterus ornatipinnis MT-ATP6 be used to study human mitochondrial diseases?

Recombinant Polypterus ornatipinnis MT-ATP6 serves as a valuable tool for understanding the molecular mechanisms of human mitochondrial diseases for several reasons:

  • Structural studies: The recombinant protein can be used in crystallography or cryo-EM studies to understand the three-dimensional structure of ATP synthase subunit a, which is difficult to achieve with human samples .

  • Functional assays: Researchers can develop in vitro assays to measure proton translocation efficiency and ATP synthesis rates using the recombinant protein incorporated into liposomes .

  • Antibody production: The recombinant protein can generate antibodies for immunological detection of MT-ATP6 in tissue samples from patients with suspected mitochondrial disorders .

  • Mutation modeling: By introducing equivalent mutations to those found in human patients, researchers can assess the functional consequences on protein stability and activity in a controlled system .

These applications provide insights into pathogenic mechanisms without the ethical and practical constraints of human tissue sampling.

What experimental approaches can be used to study the interaction between MT-ATP6 and other ATP synthase subunits?

Several methodological approaches are available to investigate the interactions between MT-ATP6 and other ATP synthase components:

  • Cross-linking studies: Chemical cross-linking followed by mass spectrometry can identify amino acid residues at protein-protein interfaces between MT-ATP6 and other subunits .

  • Co-immunoprecipitation: Using antibodies against recombinant Polypterus ornatipinnis MT-ATP6 to pull down interacting proteins from mitochondrial extracts .

  • Yeast two-hybrid assays: Modified for membrane proteins to detect specific protein-protein interactions .

  • Blue native PAGE: To visualize intact ATP synthase complexes and subcomplexes when specific subunits are mutated or absent .

  • FRET analysis: Using fluorescently labeled subunits to monitor real-time interactions and conformational changes during ATP synthesis .

These approaches help map the structural dynamics of ATP synthase and understand how MT-ATP6 mutations affect complex assembly and function.

How do researchers determine the pathogenicity of novel MT-ATP6 variants identified in patients?

Determining the pathogenicity of novel MT-ATP6 variants involves a multi-faceted approach combining clinical, genetic, and functional evidence:

  • Clinical correlation: Analyzing the association between specific variants and clinical presentations across multiple patients and families .

  • Heteroplasmy quantification: Measuring the proportion of mutant to wild-type mtDNA in affected tissues using next-generation sequencing techniques .

  • Conservation analysis: Assessing evolutionary conservation of the affected amino acid residues across species, including Polypterus ornatipinnis .

  • Yeast modeling: Introducing equivalent mutations into yeast ATP6 to measure their impact on respiratory growth and ATP synthesis, as demonstrated with variants m.8950G>A, m.9025G>A, and m.9029A>G .

  • Biochemical assays: Measuring ATP synthesis rates, oxygen consumption, and membrane potential in patient-derived cells or model systems .

  • Structural prediction: Using computational modeling to predict how amino acid substitutions affect protein structure and function .

The integration of these approaches provides compelling evidence for variant pathogenicity, as demonstrated in studies of MT-ATP6 variants associated with Leigh syndrome and other mitochondrial disorders .

What are the most frequent pathogenic mutations in MT-ATP6 and their phenotypic consequences?

The phenotypic spectrum of MT-ATP6 mutations ranges from asymptomatic carriers to severe early-onset neurodegeneration. The most significant mutations and their clinical manifestations include:

MutationPhenotypic ManifestationFrequencyBiochemical Impact
m.8993T>GLeigh syndrome, severe courseCommon (>50% of deceased patients)Severe ATP synthesis defect
m.8993T>CMilder phenotype, variable penetranceCommonModerate ATP synthesis defect
m.9025G>AProgressive neurodegenerationLess commonSignificant ATP synthase impairment
m.9029A>GVariable clinical presentationLess commonSignificant ATP synthase impairment
m.8950G>AVarious neurological disordersLess commonSignificant ATP synthase impairment

Interestingly, the degree of heteroplasmy (percentage of mutated mtDNA) does not strictly correlate with disease severity. Some patients with homoplasmic mutations (100% mutant mtDNA) show milder symptoms than those with lower percentages of certain mutations .

The clinical spectrum includes classic presentations like Leigh syndrome (73% of affected children) and NARP (Neuropathy, Ataxia, and Retinitis Pigmentosa), as well as less typical manifestations such as isolated neuropathy, ataxia, or chronic progressive external ophthalmoplegia .

Why is yeast (Saccharomyces cerevisiae) used as a model system for studying MT-ATP6 variants?

Yeast represents an excellent model system for investigating MT-ATP6 variants for several methodological reasons:

  • Genetic tractability: Yeast mitochondrial DNA can be manipulated more easily than that of mammalian cells, allowing for the introduction of specific mutations in the ATP6 gene .

  • Functional relevance: The yeast ATP6 protein shows strong evolutionary conservation with human MT-ATP6, making functional comparisons valid. Key residues affected in human patients have equivalents in yeast subunit a .

  • Homoplasmy advantage: Yeast cells cannot stably maintain heteroplasmy (mixed populations of mitochondrial DNA), which eliminates this variable when assessing mutant phenotypes .

  • Growth phenotypes: Yeast strains with ATP6 mutations show clear respiratory growth defects that can be easily quantified, providing a convenient readout of mitochondrial function .

  • Biochemical accessibility: Yeast mitochondria can be easily isolated for in-depth biochemical analysis of ATP synthesis, membrane potential, and complex assembly .

These advantages have been leveraged to demonstrate the pathogenicity of human MT-ATP6 variants such as m.8950G>A, m.9025G>A, and m.9029A>G, which significantly compromise ATP synthase function when modeled in yeast .

How are equivalent mutations mapped between human MT-ATP6 and other species for functional studies?

Mapping equivalent mutations between human MT-ATP6 and other species involves sophisticated alignment and structural comparison techniques:

  • Multiple sequence alignment: Researchers align MT-ATP6 sequences from various species including Polypterus ornatipinnis and identify conserved domains and residues .

  • Structural homology modeling: Using available crystal structures of ATP synthase components to predict the three-dimensional positions of specific residues .

  • Functional domain mapping: Identifying critical functional domains such as proton channels and subunit interfaces that are conserved across species .

  • Residue numbering conversion: Developing conversion tables that translate residue positions between species. For example, human p.I106T (m.8843T>C) corresponds to yeast a.I123T, and human p.V142I (m.8950G>A) to yeast a.V159I .

This methodical approach enables researchers to introduce human disease-associated mutations into model organisms like yeast or to develop recombinant proteins with equivalent mutations for functional studies. The strong conservation of ATP synthase across evolution makes these cross-species comparisons scientifically valid and informative .

What are the optimal methods for expressing and purifying recombinant Polypterus ornatipinnis MT-ATP6?

Expressing and purifying recombinant MT-ATP6 presents significant technical challenges due to its hydrophobic nature and mitochondrial origin. The optimal methodological approach includes:

  • Expression system selection:

    • Bacterial systems (E. coli) using specialized strains for membrane proteins

    • Yeast expression systems that provide a eukaryotic environment

    • Cell-free expression systems for toxic or difficult-to-express membrane proteins

  • Construct design:

    • Addition of purification tags (His, FLAG, etc.) that don't interfere with protein folding

    • Optimization of codon usage for the expression host

    • Inclusion of appropriate signal sequences for membrane targeting

  • Solubilization and purification:

    • Gentle extraction using detergents like DDM, LMNG, or GDN

    • Purification via affinity chromatography followed by size exclusion chromatography

    • Quality control via circular dichroism to verify proper folding

  • Storage considerations:

    • Storage in glycerol-containing buffers at -20°C or -80°C

    • Aliquoting to avoid freeze-thaw cycles

    • Optimization of detergent concentration for long-term stability

These approaches have been successfully applied to ATP synthase components, enabling structural and functional studies of this complex enzyme.

How can researchers functionally characterize recombinant MT-ATP6 in vitro?

Functional characterization of recombinant MT-ATP6 requires specialized techniques to assess its role in ATP synthase activity:

  • Proteoliposome reconstitution:

    • Incorporation of purified MT-ATP6 along with other ATP synthase subunits into artificial liposomes

    • Creating a proton gradient across the liposome membrane using pH shifts or ionophores

  • ATP synthesis assays:

    • Measurement of ATP production using luciferase-based luminescence assays

    • Quantification of ATP synthesis rates under different conditions (pH, temperature, substrate concentration)

  • Proton translocation measurements:

    • Using pH-sensitive fluorescent dyes to monitor proton movement across membranes

    • Patch-clamp techniques to measure proton currents through reconstituted channels

  • Protein-protein interaction studies:

    • Surface plasmon resonance to measure binding kinetics with other subunits

    • Isothermal titration calorimetry to determine binding thermodynamics

  • Structural integrity assessment:

    • Circular dichroism spectroscopy to analyze secondary structure

    • Limited proteolysis to probe folding and stability

These methods provide critical insights into how MT-ATP6 contributes to ATP synthase function and how mutations might impair energy production in mitochondrial disorders.

How does understanding MT-ATP6 function influence the development of therapeutic strategies for mitochondrial disorders?

Understanding MT-ATP6 function has direct implications for developing therapeutic approaches for mitochondrial disorders:

  • Metabolic bypass strategies: Knowledge of how MT-ATP6 mutations impair ATP synthesis has led to approaches that bypass oxidative phosphorylation, such as ketogenic diets that provide alternative energy sources for the brain .

  • Gene therapy approaches: Research into MT-ATP6 has informed the development of mitochondrially targeted nucleic acids that could potentially correct or compensate for mutated genes .

  • Small molecule screening: Structural and functional information about MT-ATP6 enables the screening of compounds that might stabilize ATP synthase function in the presence of mutations .

  • Mitochondrial replacement therapy: Understanding the critical role of MT-ATP6 in energy production provides rationale for techniques that replace the entire mitochondrial genome in affected embryos .

  • Biomarker development: Functional studies of MT-ATP6 variants help identify biochemical signatures that can serve as biomarkers for disease progression and treatment response .

These therapeutic strategies are in various stages of development, with some (like dietary modifications) already in clinical use, while others remain experimental but promising avenues for future treatment.

What are the current challenges in correlating MT-ATP6 genotypes with clinical phenotypes?

Researchers face several significant challenges when attempting to correlate MT-ATP6 genotypes with clinical phenotypes:

  • Heteroplasmy complexity: The percentage of mutated mtDNA can vary between tissues and change over time, complicating the prediction of disease severity. Studies have shown that heteroplasmy levels don't reliably predict clinical outcomes .

  • Intrafamilial variability: Even individuals with identical MT-ATP6 mutations and similar heteroplasmy levels can present with dramatically different clinical manifestations. For example, monozygotic twin sisters with homoplasmic m.8993T>C mutation showed vastly different severities of ataxia .

  • Tissue-specific effects: MT-ATP6 mutations may affect high-energy demanding tissues differently, resulting in varied clinical presentations depending on which tissues are most impacted .

  • Nuclear genetic modifiers: Nuclear genes may modify the expression and impact of MT-ATP6 mutations, contributing to phenotypic variability .

  • Limited genotype-phenotype databases: Despite growing cohorts, the number of patients with specific MT-ATP6 variants remains relatively small, limiting statistical power for correlations .

  • Diagnostic delays: The wide phenotypic spectrum leads to delays in diagnosis, particularly for adult-onset and oligosymptomatic presentations, potentially skewing our understanding of natural history .

These challenges highlight the need for comprehensive, longitudinal studies of MT-ATP6 mutation carriers and the integration of multiple data types to improve predictive models of disease progression and severity.

What emerging technologies could enhance our understanding of MT-ATP6 function and pathology?

Several cutting-edge technologies are poised to revolutionize MT-ATP6 research:

  • Cryo-electron microscopy: Advanced cryo-EM techniques now enable visualization of ATP synthase at near-atomic resolution, providing unprecedented insights into how MT-ATP6 mutations affect enzyme structure and function .

  • Single-cell mtDNA sequencing: New methods for analyzing mtDNA at the single-cell level can reveal heteroplasmy dynamics and tissue-specific distribution of MT-ATP6 mutations with extraordinary precision .

  • CRISPR-based mitochondrial genome editing: Emerging technologies for precise editing of mtDNA could enable the creation of improved cellular and animal models of MT-ATP6 disorders .

  • Real-time ATP imaging in living cells: Genetically encoded ATP sensors allow for the visualization of ATP dynamics in living cells, providing insights into the spatiotemporal aspects of MT-ATP6 dysfunction .

  • Organoid models: Patient-derived organoids can recapitulate tissue-specific effects of MT-ATP6 mutations in a physiologically relevant context .

  • Artificial intelligence for variant interpretation: Machine learning approaches are being developed to better predict the functional consequences of novel MT-ATP6 variants based on sequence, structure, and conservation data .

These technologies promise to bridge current knowledge gaps and potentially lead to more effective therapeutic strategies for patients with MT-ATP6-related disorders.

How might comparative studies between MT-ATP6 from different species inform human disease research?

Comparative studies of MT-ATP6 across species provide valuable insights that can inform human disease research:

  • Evolutionary adaptation insights: Species living in different environments (like the aquatic Polypterus ornatipinnis) may have evolved ATP synthase adaptations that provide clues about structural flexibility and functional constraints of MT-ATP6 .

  • Natural resistance mechanisms: Some species may naturally tolerate variations in MT-ATP6 that would be pathogenic in humans, suggesting compensatory mechanisms that could be therapeutic targets .

  • Functional domain mapping: Comparing the consequences of equivalent mutations across species helps identify the most critical functional domains and residues in MT-ATP6 .

  • Alternative energy pathways: Species with unique metabolic adaptations may reveal alternative energy production pathways that could be exploited therapeutically in humans with MT-ATP6 mutations .

  • Structural variation tolerance: Understanding which regions of MT-ATP6 tolerate variation between species can help distinguish potentially pathogenic variants from benign polymorphisms in human patients .

These comparative approaches have already yielded valuable insights, such as the demonstration that yeast models can accurately predict the pathogenicity of human MT-ATP6 variants, validating their use in functional genomics screening .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.