Recombinant Polypterus ornatipinnis Cytochrome c oxidase subunit 2 (mt-co2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Polypterus ornatipinnis Cytochrome c Oxidase Subunit 2 (mt-co2)

Polypterus ornatipinnis, commonly known as the Ornate Bichir, is a species of freshwater fish native to the Congo River basin in Africa . It belongs to the family Polypteridae, which are primitive ray-finned fish with elongated bodies and distinctive dorsal finlets . Cytochrome c oxidase subunit 2 (mt-co2) is a subunit of the cytochrome c oxidase enzyme complex, which is essential for cellular respiration in eukaryotes .

Recombinant Polypterus ornatipinnis Cytochrome c oxidase subunit 2 (mt-co2) refers to the protein that has been produced using recombinant DNA technology . This involves isolating the gene encoding mt-co2 from Polypterus ornatipinnis, cloning it into a suitable expression vector, and expressing it in a host organism such as E. coli . The recombinant protein can then be purified and used for various research and industrial applications .

Characteristics of Polypterus ornatipinnis

Polypterus ornatipinnis is characterized by its distinctive appearance and evolutionary significance . Key features include:

  • Physical Description The Ornate Bichir has an elongated body with a series of dorsal finlets along its back. It features a dark base color, adorned with contrasting yellow and white speckling . This fish can grow to over 60 cm in length .

  • Habitat Native to the Congo River basin, this species thrives in freshwater environments .

  • Breeding Unlike many other species, Polypterus ornatipinnis has been successfully bred in home aquariums, with hobby breeders achieving reproduction in tanks as small as 120 cm in edge length .

  • Diet Bichirs are obligate carnivores and consume a variety of foods, including frozen and live foods when young, and larger chunks such as earthworms and fish meat as adults .

  • Behavior They are generally peaceful towards other fish that are not suitable as food and tend to ignore plants unless they obstruct their path .

Applications of Recombinant mt-co2

Recombinant mt-co2 has several applications in scientific research :

  • ELISA Assays Recombinant mt-co2 can be used as a standard or antigen in Enzyme-Linked Immunosorbent Assays (ELISA) to detect and quantify mt-co2 antibodies or the protein itself in biological samples .

  • Structural Studies Recombinant production allows for the creation of sufficient quantities of the protein for structural analysis via X-ray crystallography or NMR, providing insights into its function .

  • Functional Studies The purified recombinant protein can be used in in vitro assays to study its enzymatic activity, interaction with other proteins, and response to various inhibitors or activators .

RyR Gene Expression

Research has identified four RyR genes, RyR1a, RyR1b, RyR2, and RyR3, within the Polypterus ornatipinnis genome, which are categorized phylogenetically with their vertebrate orthologs . Quantitative real-time PCR analysis reveals fiber-type specific expression of the RyR1a and RyR1b genes .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is defined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
mt-co2; coii; coxii; mtco2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Polypterus ornatipinnis (Ornate bichir)
Target Names
Target Protein Sequence
MAHPTQLGLQDASSPIMEELLLFHDHALMTVFLISTLVLYIIMTAVSTKLTNKHLLDAQE IEIVWTVMPALVLIAIALPSLRILYLMDEINDPHLTIKATGHQWYWSYEYTDYDTLNFDS YMIPTQDLLPGQFRLLDTDNRMVVPTGSPVRMLITAEDVLHSWAVPSLGLKMDAVPGRLN QTTFIATRPGVFFGQCSEICGANHSFMPITIESAPVKYFESWSSSMLAES
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (mt-co2) is a component of cytochrome c oxidase (Complex IV), the terminal enzyme in the mitochondrial electron transport chain (ETC). The ETC, comprised of Complexes I-IV, facilitates oxidative phosphorylation by transferring electrons from NADH and succinate to molecular oxygen. This process generates a proton gradient across the inner mitochondrial membrane, driving ATP synthesis. Specifically, mt-co2 plays a crucial role in cytochrome c oxidase, catalyzing the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the CuA center (subunit 2) and heme a (subunit 1) to the binuclear center (BNC) in subunit 1, consisting of heme a3 and CuB. The BNC utilizes four electrons from cytochrome c and four protons from the matrix to reduce molecular oxygen to two water molecules.
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Cytochrome c oxidase subunit 2 (mt-co2) and why is it significant in Polypterus ornatipinnis research?

Cytochrome c oxidase subunit 2 (mt-co2) is a mitochondrially encoded protein that contributes to cytochrome-c oxidase activity. In Polypterus ornatipinnis (Ornate Bichir), this protein plays a crucial role in the respiratory chain complex IV, located in the mitochondrial inner membrane. Its significance stems from its involvement in mitochondrial electron transport processes, specifically in the cytochrome c to oxygen pathway .

The mt-co2 gene in P. ornatipinnis has been valuable in evolutionary biology research, particularly in determining the phylogenetic position of bichirs among vertebrates. Sequence analysis of this protein, along with other mitochondrial genes, has helped establish bichirs as the most basal living members of ray-finned fish (Actinopterygii) rather than lobe-finned fish (Sarcopterygii) .

How does the mitochondrial genome of Polypterus ornatipinnis compare to other vertebrates?

The complete mitochondrial genome of Polypterus ornatipinnis has been fully sequenced (16,624 bp) and contains 13 protein-coding genes (including mt-co2), 22 tRNAs, two rRNAs, and one major noncoding region . This genomic organization is significant because:

  • It represents the most basal vertebrate that conforms to the consensus vertebrate mtDNA gene order.

  • Sequence analysis shows greater similarity to ray-finned fish than to either lamprey or lungfish.

  • The structure confirms the bichir's placement as the most basal living member of ray-finned fish.

Comparative analysis with other vertebrates indicates that bichir mitochondrial genes have remained remarkably conserved despite their ancient evolutionary position, making them valuable for understanding the evolution of vertebrate mitochondrial genomes .

What are the optimal conditions for expressing recombinant Polypterus ornatipinnis mt-co2 in bacterial systems?

For optimal expression of recombinant Polypterus ornatipinnis mt-co2 in bacterial systems, researchers should consider the following methodological approach:

  • Expression System Selection: E. coli BL21(DE3) or similar strains are recommended due to their reduced protease activity and high expression capabilities for mitochondrial proteins.

  • Buffer Composition: Use Tris-based buffer systems with 50% glycerol for storage stability, as optimized for this specific protein .

  • Temperature and Induction Parameters:

    ParameterOptimal RangeNotes
    Growth temperature30-37°CLower temperatures for soluble expression
    Induction temperature16-25°CReduced temperature post-induction increases solubility
    IPTG concentration0.1-0.5 mMLower concentrations favor properly folded protein
    Induction duration4-16 hoursLonger at lower temperatures
  • Protein Enrichment: For functional studies, enrichment with purified human cytochrome b5 can be accomplished through preincubation at room temperature with intermittent gentle mixing in 50mM potassium phosphate buffer (pH 7.7) and 0.5mM DETAPAC .

  • Post-Expression Handling: After extraction, store working aliquots at 4°C for up to one week. For extended storage, maintain at -20°C or -80°C, avoiding repeated freeze-thaw cycles .

How can researchers assay the activity of recombinant Polypterus ornatipinnis mt-co2?

Assaying the activity of recombinant Polypterus ornatipinnis mt-co2 requires specific methodological considerations:

  • Standard Reaction Mixture Preparation:

    • 50mM potassium phosphate buffer, pH 7.4

    • 0.5mM DETAPAC (diethylenetriaminepentaacetic acid)

    • Appropriate amounts of recombinant protein (typically 1-10 pmol)

    • Selected substrate appropriate for cytochrome c oxidase activity measurement

  • NADPH-Dependent Activity Measurement:
    Initiate reactions by adding a mixture containing:

    • NADPH (0.1mM final concentration)

    • NADPH regenerating system consisting of:

      • Glucose-6-phosphate (10.0mM)

      • Glucose-6 phosphate dehydrogenase (0.5 U/ml)

  • H₂O₂ Formation Measurement:

    • Use 96-well black flat-bottom microplates

    • Add 60μl of reaction mixture containing 50mM potassium phosphate buffer (pH 7.7), 1.0mM sodium azide, and 0.5mM DETAPAC

    • Add 5-10μl of recombinant preparation (2.0-10.0 pmol of cytochrome P450 enzyme/assay)

    • Preincubate at 37°C for 5 minutes

    • Initiate reaction with 10μl NADPH and regenerating system

    • Terminate reactions with 25μl acetonitrile with rapid mixing

  • Fluorescence-Based Detection:

    • Use Amplex Red (AR)/horseradish peroxidase (HRP) system for H₂O₂ detection

    • AR/HRP added after reaction termination to prevent interference from resorufin redox cycling

    • Measure fluorescence using a microplate reader in fluorescence mode

What purification strategies yield the highest purity and activity of recombinant Polypterus ornatipinnis mt-co2?

Effective purification of recombinant Polypterus ornatipinnis mt-co2 requires a multi-step approach to maintain structural integrity and enzymatic activity:

  • Initial Extraction:

    • Lyse cells in buffer containing 50mM potassium phosphate (pH 7.4), 0.5mM DETAPAC, and protease inhibitors

    • Centrifuge at 10,000×g for 15 minutes to remove cell debris

    • Collect supernatant containing soluble protein fraction

  • Affinity Chromatography:

    • For tagged recombinants, utilize appropriate affinity resins (note that tag type may vary depending on production process)

    • For untagged proteins, consider cytochrome c affinity columns based on protein function

    • Elute with gradient of imidazole (for His-tagged proteins) or other appropriate elution buffers

  • Secondary Purification:

    • Ion exchange chromatography on DEAE or SP Sepharose depending on protein's isoelectric point

    • Size exclusion chromatography to separate monomeric protein from aggregates and contaminants

  • Quality Control Parameters:

    ParameterAcceptable RangeMethod of Determination
    Purity>95%SDS-PAGE with Coomassie staining
    Activity>70% of theoreticalSpectrophotometric cytochrome c oxidation assay
    Oligomeric statePrimarily monomericSize exclusion chromatography
    Stability<10% activity loss after 1 week at 4°CComparative activity assays
  • Storage Recommendations:

    • Store in Tris-based buffer with 50% glycerol

    • Aliquot to avoid freeze-thaw cycles

    • Maintain at -20°C for short-term or -80°C for extended storage

How does the structure and function of Polypterus ornatipinnis mt-co2 compare with human mt-co2 for respiratory research models?

Comparative analysis between Polypterus ornatipinnis mt-co2 and human mt-co2 reveals important structural and functional insights relevant to respiratory research models:

  • Sequence Conservation:
    Despite evolutionary distance, key functional domains show significant conservation, particularly in regions involved in:

    • Heme binding pockets

    • Proton translocation pathways

    • Subunit interface residues

  • Functional Divergence:
    Bichir mt-co2 exhibits adaptations potentially related to its ability to survive in oxygen-depleted waters:

    • Modified oxygen binding kinetics

    • Potentially altered proton pumping efficiency

    • Variations in regulatory sites that may affect activity under hypoxic conditions

  • Structural Implications for Research Models:
    The primitive nature of Polypterus ornatipinnis provides unique advantages as a research model:

    • Represents an evolutionary intermediate state of respiratory proteins

    • May illuminate ancestral functions lost in mammalian lineages

    • Offers insights into adaptations for facultative air-breathing in vertebrates

  • Regulatory Mechanisms:
    Studies suggest potential differences in regulation:

    • The Respiratory Supercomplex Factor 1 (Rcf1) or analogous proteins may interact differently with bichir mt-co2

    • Midpoint potential differences may affect electron transfer kinetics

    • Oxygen binding and trapping mechanisms likely show adaptations related to the bichir's amphibious capabilities

What role does recombinant Polypterus ornatipinnis mt-co2 play in understanding evolutionary relationships among vertebrates?

Recombinant Polypterus ornatipinnis mt-co2 has been instrumental in resolving longstanding questions about vertebrate evolution:

  • Phylogenetic Significance:
    Molecular analysis of recombinant mt-co2 and other mitochondrial proteins has helped:

    • Establish bichirs as the most basal living members of ray-finned fish

    • Rule out their classification as lobe-finned fish

    • Determine that their lobe-fins evolved independently from those of Sarcopterygii

  • Molecular Clock Applications:
    The sequence data from recombinant mt-co2 serves as a calibration point for:

    • Estimating divergence times between major vertebrate lineages

    • Understanding the rate of molecular evolution in mitochondrial genes

    • Tracking the conservation of respiratory function across evolutionary time

  • Functional Evolution Research:
    Expressing recombinant mt-co2 allows for comparative biochemical studies that:

    • Demonstrate functional constraints on evolution of respiratory proteins

    • Identify adaptations specific to different vertebrate lineages

    • Map functional changes to specific amino acid substitutions

  • Application in Broader Evolutionary Studies:
    The bichir mt-co2 sequence data contributes to:

    • Understanding the evolution of mitochondrial gene order in vertebrates

    • Resolving contentious relationships in the vertebrate phylogenetic tree

    • Providing insights into adaptations for the transition to terrestrial environments

What are the methodological challenges in studying hydrogen peroxide generation in recombinant Polypterus ornatipinnis mt-co2 compared to human cytochrome oxidase?

Studying hydrogen peroxide generation in recombinant Polypterus ornatipinnis mt-co2 presents several methodological challenges compared to human cytochrome oxidase systems:

  • Assay Interference Issues:
    When measuring H₂O₂ production, researchers must be aware that:

    • Resorufin redox cycling can interfere with accurate quantification

    • AR/HRP should be added only after enzyme reactions are terminated

    • Acetonitrile (25% final concentration) effectively stops NADPH-dependent electron transport without affecting AR/HRP assay activity

  • Reaction Conditions Optimization:

    ParameterHuman Cytochrome OxidaseP. ornatipinnis mt-co2Methodological Implication
    pH optimum7.0-7.47.4-7.7Buffer adjustment needed for maximum activity
    Temperature sensitivityModeratePotentially higherTemperature control critical during assays
    Substrate specificityWell-characterizedLess documentedCareful substrate selection required
    Cofactor requirementsEstablishedMay differOptimization of cofactor concentrations needed
  • Detection System Adaptations:

    • For accurate H₂O₂ measurement in microsomal enzyme preparations containing mt-co2:

      • Run assays in 96-well black flat-bottom microplates

      • Use reaction mixture containing specific buffer components (50mM potassium phosphate, pH 7.7, 1.0mM sodium azide, 0.5mM DETAPAC)

      • Add precisely measured amounts of recombinant preparation (2.0-10.0 pmol)

      • Terminate reactions with acetonitrile for accurate downstream analysis

  • Species-Specific Considerations:

    • The primitive nature of Polypterus ornatipinnis respiratory systems may result in:

      • Different electron leakage patterns during oxidative phosphorylation

      • Unique regulatory mechanisms affecting ROS production

      • Adaptations related to survival in oxygen-variable environments that alter catalytic properties

      • Potential differences in reaction to inhibitors or activators used in standard assays

How can recombinant Polypterus ornatipinnis mt-co2 contribute to understanding mitochondrial adaptations in vertebrates with specialized respiratory systems?

Recombinant Polypterus ornatipinnis mt-co2 offers unique insights into mitochondrial adaptations in vertebrates with specialized respiratory systems:

  • Dual Respiratory Mode Adaptations:
    The Ornate Bichir possesses both gills and primitive lungs, making its mt-co2:

    • A model for understanding molecular adaptations to facultative air-breathing

    • Valuable for studying electron transport chain function under variable oxygen conditions

    • Informative about evolutionary intermediates in the transition to air-breathing

  • Experimental Applications:
    Recombinant mt-co2 can be used to:

    • Compare enzymatic properties under aquatic versus aerial respiratory conditions

    • Study the effects of oxygen tension on electron transport efficiency

    • Investigate molecular adaptations that permit survival in oxygen-depleted waters

  • Comparative Analysis Framework:
    Using recombinant Polypterus ornatipinnis mt-co2 as a reference point allows researchers to:

    • Track evolutionary changes in respiratory proteins across vertebrate lineages

    • Identify convergent adaptations in unrelated air-breathing fish

    • Map functional domains critical for adaptation to different respiratory modes

  • Biomanufacturing Relevance:
    Understanding these adaptations has broader applications:

    • Design of oxygen-efficient bioreactors based on primitive respiratory systems

    • Development of CO₂-based manufacturing systems for recombinant protein production

    • Insights into optimizing oxygen utilization in industrial fermentation processes

What techniques are most effective for analyzing the interaction between recombinant Polypterus ornatipinnis mt-co2 and other components of the respiratory chain?

For analyzing interactions between recombinant Polypterus ornatipinnis mt-co2 and other respiratory chain components, several specialized techniques have proven effective:

  • Co-Immunoprecipitation Studies:

    • Use antibodies against recombinant mt-co2 to pull down interacting partners

    • Verify interactions through western blotting or mass spectrometry

    • Compare interaction patterns with those of other vertebrate species

  • Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE):

    • Preserves native protein complexes for analysis

    • Allows identification of respiratory supercomplexes containing mt-co2

    • Can be followed by second-dimension SDS-PAGE to identify components

  • Isothermal Titration Calorimetry (ITC):

    • Quantitatively measures binding between mt-co2 and potential partners

    • Determines thermodynamic parameters of interactions

    • Particularly effective for analyzing metal binding in peptides derived from the protein

  • Functional Reconstitution Assays:

    • Incorporate recombinant mt-co2 into liposomes or nanodiscs

    • Add purified components of respiratory chain sequentially

    • Measure activity changes to determine functional interactions

    • Protocols can be adapted from those used to study the regulation of cytochrome c oxidase activity by modulation of mitochondrial electric fields

  • Spectroscopic Methods:

    • Use circular dichroism to define electronic structure of metal-binding regions

    • Apply resonance Raman spectroscopy to study heme interactions

    • Employ FTIR to examine conformational changes upon binding

  • Crosslinking Mass Spectrometry:

    • Apply chemical crosslinkers to stabilize transient interactions

    • Identify interaction interfaces through mass spectrometry analysis

    • Map the topology of the protein complex architecture

How does the study of recombinant Polypterus ornatipinnis mt-co2 inform our understanding of mitochondrial disease mechanisms?

The study of recombinant Polypterus ornatipinnis mt-co2 provides valuable insights into mitochondrial disease mechanisms through several research avenues:

  • Evolutionary Conservation Analysis:

    • Identification of highly conserved residues across species indicates functionally critical regions

    • Mutations in these conserved regions in humans often correlate with mitochondrial diseases

    • Comparison with human mt-co2 highlights domains under strong selective pressure

  • Structure-Function Relationships:

    • The primitive nature of bichir mt-co2 allows identification of ancestral functions

    • Recombinant protein studies can reveal how specific mutations affect:

      • Electron transfer efficiency

      • Proton pumping capability

      • Oxygen reduction capacity

      • Complex assembly and stability

  • Disease-Associated Variants:
    Reference to human mt-co2 gene reveals association with:

    Disease/ConditionAssociated MechanismRelevant Conserved Domain
    MELAS syndromeDisrupted electron transportRegions involved in subunit interactions
    Huntington's diseaseBiomarker associationElectron transfer domains
    Stomach cancerBiomarker for detectionRegulatory regions
  • Functional Divergence and Disease Resilience:

    • Studies of recombinant mt-co2 from species adapted to extreme conditions (like Polypterus with its ability to survive in oxygen-depleted waters) can reveal:

      • Protective mechanisms against oxidative stress

      • Alternative electron pathways that bypass damaged components

      • Adaptations that might inspire therapeutic approaches for mitochondrial disorders

  • Experimental Disease Models:

    • Recombinant mt-co2 can be used to:

      • Create in vitro models of respiratory chain dysfunction

      • Test compounds for restoration of impaired function

      • Study the effects of environmental toxins on respiratory chain components

What are the current challenges in producing high-yield, functionally active recombinant Polypterus ornatipinnis mt-co2 for structural studies?

Producing high-yield, functionally active recombinant Polypterus ornatipinnis mt-co2 for structural studies presents several challenges that researchers are actively addressing:

  • Expression Host Limitations:

    • Prokaryotic systems often struggle with proper folding of mitochondrial proteins

    • Eukaryotic systems may introduce post-translational modifications not present in the native protein

    • Recent approaches utilizing CO₂-based manufacturing systems for recombinant protein production show promise for improving yield and quality

  • Cofactor Incorporation Issues:

    • Proper incorporation of heme groups is essential for functional studies

    • Methods being developed include:

      • Co-expression with heme biosynthesis enzymes

      • In vitro reconstitution protocols

      • Heme precursor supplementation during expression

  • Structural Stabilization Strategies:

    • Current research focuses on:

      • Optimized buffer systems for maintaining native conformation

      • Use of amphipols or nanodiscs to stabilize membrane proteins

      • Site-directed mutagenesis to improve stability without affecting function

      • Storage in Tris-based buffer with 50% glycerol to prevent degradation

  • Purity and Homogeneity Requirements:

    • For structural studies (X-ray crystallography, cryo-EM), protein homogeneity is crucial

    • Recent advances in purification include:

      • Tandem affinity tags with TEV cleavage sites

      • Optimization of chromatography conditions specific to bichir proteins

      • Use of specialized detergents for membrane protein extraction

  • Experimental Design Considerations:

    • The unique properties of mt-co2 from air-breathing fish require:

      • Careful consideration of oxygen levels during purification

      • Protection from oxidative damage

      • Specialized activity assays that account for the unique enzyme kinetics

How can computational modeling enhance our understanding of Polypterus ornatipinnis mt-co2 function and evolution?

Computational modeling offers powerful approaches to understand Polypterus ornatipinnis mt-co2 function and evolution:

  • Homology Modeling and Molecular Dynamics:

    • Generation of 3D structural models based on existing cytochrome c oxidase structures

    • Simulation of protein dynamics under various oxygen concentrations

    • Prediction of conformational changes during the catalytic cycle

    • Investigation of water molecule pathways relevant to proton pumping

  • Evolutionary Rate Analysis:

    • Calculation of site-specific evolutionary rates to identify functional constraints

    • Comparison with other vertebrate lineages to detect signatures of selection

    • Correlation of evolutionary rates with structural and functional domains

    • Application of similar approaches used in phylogenetic studies of bichir mitochondrial DNA

  • Protein-Protein Interaction Prediction:

    • Docking simulations between mt-co2 and other respiratory chain components

    • Identification of critical interface residues for complex assembly

    • Prediction of regulatory binding sites

    • Modeling of interactions with regulators like the Respiratory Supercomplex Factor 1 (Rcf1)

  • Quantum Mechanical Calculations:

    • Modeling of electron transfer pathways through the protein

    • Calculation of redox potentials for metal centers

    • Prediction of oxygen binding and activation mechanisms

    • Similar to approaches used to define possible geometries for metal-peptide complexes in metallochaperones

  • Integration with Experimental Data:

    • Refinement of models based on spectroscopic measurements

    • Validation of predicted binding sites through mutagenesis

    • Improvement of functional predictions through machine learning approaches trained on experimental data

    • Development of quantitative structure-function relationship models

What potential biotechnological applications exist for recombinant Polypterus ornatipinnis mt-co2 in bioenergy and environmental research?

Recombinant Polypterus ornatipinnis mt-co2 presents several promising biotechnological applications in bioenergy and environmental research:

  • Biofuel Cell Development:

    • The efficient oxygen reduction properties of mt-co2 make it potential catalysts for biofuel cell cathodes

    • Its adaptation to function in low-oxygen environments offers advantages for microbial fuel cells operating in sediment or wastewater environments

    • Integration into enzymatic cascades for improved electron transfer efficiency

  • Carbon Capture Technologies:

    • Incorporation into CO₂-based manufacturing systems similar to those being developed for recombinant protein production

    • Potential integration with systems using thermal stable carbonic anhydrase to increase efficiency of CO₂ capture

    • Development of biohybrid materials that combine the oxygen-reduction capabilities of mt-co2 with synthetic catalysts

  • Biosensors for Environmental Monitoring:

    • Development of electrode-based biosensors for oxygen detection in aquatic environments

    • Creation of H₂O₂ sensing platforms based on the catalytic properties of the enzyme

    • Integration into multi-enzyme arrays for monitoring respiratory inhibitors in environmental samples

    • Methodology similar to that used to measure H₂O₂ generated by microsomal enzymes

  • Bioremediation Applications:

    • Engineering of bacterial systems expressing recombinant mt-co2 for enhanced survival in contaminated environments

    • Development of enzymatic systems for degradation of organic pollutants coupled to oxygen reduction

    • Creation of biohybrid materials combining mt-co2 with nanoparticles for enhanced catalytic activity

  • Comparative Systems for Climate Change Research:

    • Use of the primitive respiratory system components to understand adaptations to varying oxygen and CO₂ levels

    • Development of model systems to study effects of ocean acidification on respiratory physiology

    • Creation of experimental platforms to investigate adaptation mechanisms to changing atmospheric conditions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.