Recombinant Polypterus ornatipinnis NADH-ubiquinone oxidoreductase chain 6 (MT-ND6)

Shipped with Ice Packs
In Stock

Description

Functional Role and Research Significance

MT-ND6 is critical for Complex I assembly and function in mitochondria. In humans, mutations in the homologous MT-ND6 gene are linked to mitochondrial disorders, including:

  • Leber’s Hereditary Optic Neuropathy (LHON): A T14484C mutation (Met64Val) disrupts electron transport, causing vision loss .

  • Leigh’s Syndrome: A G14459A mutation (Ala72Val) impairs Complex I activity, leading to neurodegeneration .

Recombinant MT-ND6 serves as a model to study:

  1. Protein-Protein Interactions: Binding partners include NDUFS3 (iron-sulfur cluster assembly) and YME1L1 (mitochondrial protease) .

  2. Structural Dynamics: Hydrophobic transmembrane domains and peripheral hydrophilic regions critical for electron transfer .

  3. Disease Mechanisms: Mutant variants for studying pathogenicity in vitro .

Applications in Research

The recombinant protein is utilized in:

  • ELISA Kits: For detecting MT-ND6-specific antibodies in immunological studies .

  • Biochemical Assays: Analyzing NADH-ubiquinone reductase activity and Complex I assembly .

  • Structural Biology: Cryo-EM or X-ray crystallography to resolve transmembrane domains .

  • Species Specificity: The ornate bichir-derived MT-ND6 may differ from human orthologs in function or stability, necessitating comparative studies.

  • Thermal Stability: Lyophilized proteins require careful handling to avoid denaturation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag type, please inform us, and we will prioritize its development.
Synonyms
MT-ND6; MTND6; NADH6; ND6; NADH-ubiquinone oxidoreductase chain 6; NADH dehydrogenase subunit 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Polypterus ornatipinnis (Ornate bichir)
Target Names
Target Protein Sequence
MVLMVVFSVMFLISLIAVASNPSPYFAAFGLMVGAGVGCGMLMQCGMTFLSMILFLIYLG GMLVVFAYSPALAAEPYPNAWGSWEVFSYVLVYMFLVIVAWVAFVGDMELFDDVEEYFGA MRRYVGVAEVYNAGGYMLFIAGWVLLMALLVVLELTRGYSRGCLRAV
Uniprot No.

Target Background

Function

Recombinant Polypterus ornatipinnis NADH-ubiquinone oxidoreductase chain 6 (MT-ND6): A core subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I). It is considered part of the minimal assembly necessary for catalytic activity. Complex I facilitates electron transfer from NADH to the respiratory chain, with ubiquinone believed to be the immediate electron acceptor.

Protein Families
Complex I subunit 6 family
Subcellular Location
Mitochondrion membrane; Multi-pass membrane protein.

Q&A

What is the structure and function of MT-ND6 in mitochondrial respiration?

MT-ND6 is a critical subunit of Complex I (NADH:ubiquinone oxidoreductase) in the mitochondrial electron transport chain. Structurally, MT-ND6 is located at the junction between the P and Q modules of Complex I and contains multiple transmembrane alpha helices. The protein plays a pivotal role in creating the E-channel that facilitates electron flow within Complex I. Recent molecular dynamics simulations have demonstrated that MT-ND6 contributes significantly to the conformational stability of the entire respiratory complex .

The full-length MT-ND6 contains C-terminal alpha helices that are essential for interaction with other subunits in the Q module. Truncation or mutation of these regions can disrupt these interactions, leading to destabilization of Complex I and reduced OXPHOS (oxidative phosphorylation) activity .

How evolutionarily conserved is MT-ND6 across species?

MT-ND6 demonstrates remarkable evolutionary conservation across vertebrate species, including between humans and fish species like Polypterus ornatipinnis. This conservation reflects the critical role of MT-ND6 in maintaining mitochondrial function. While the core functional domains show high conservation, species-specific variations exist, particularly in regions less critical for electron transport.

Sequence comparison between human and P. ornatipinnis MT-ND6 reveals conservation of key functional motifs, though specific amino acid variations reflect evolutionary adaptations to different metabolic requirements and environmental conditions .

What techniques are available for isolating and characterizing native MT-ND6?

Isolation and characterization of native MT-ND6 typically involves:

  • Mitochondrial isolation using differential centrifugation

  • Solubilization of mitochondrial membranes using detergents such as digitonin or n-dodecyl-β-D-maltoside (DDM)

  • Separation of mitochondrial complexes using Blue Native Polyacrylamide Gel Electrophoresis (BN-PAGE)

  • Western blotting with specific antibodies against N-terminal or C-terminal epitopes

Researchers should consider using both N-terminal and C-terminal specific antibodies for comprehensive detection, especially when investigating potential truncated forms. For example, in studies of mutated ND6, using antibodies targeting different regions (α-ND6 C-term and α-ND6 N-term) has revealed the presence of both full-length and truncated proteins in heteroplasmic samples .

What are the optimal conditions for recombinant expression of MT-ND6?

The optimal expression of recombinant MT-ND6 requires addressing several technical challenges:

  • Codon optimization: Mitochondrial genes use non-universal genetic code, requiring codon optimization for successful nuclear expression. Specifically, changing the 6 non-universal codons to universal codons, as demonstrated in allotopic expression studies .

  • Addition of mitochondrial targeting sequence: Including a mitochondrial targeting sequence (such as COX8) to ensure proper localization of the recombinant protein to mitochondria .

  • Expression vector selection: Vectors such as pCDH-puro have been successfully used for stable expression of mitochondrial genes .

  • Cell line selection: Cybrid cell lines (cytoplasmic hybrids) are preferred for studying mitochondrial gene expression and function .

For storage of recombinant protein, a Tris-based buffer with 50% glycerol is recommended to maintain stability. Storage at -20°C is adequate for short-term, while -80°C is preferred for extended storage periods .

How can researchers assess the functional integration of recombinant MT-ND6 into mitochondrial Complex I?

Assessment of functional integration requires multiple complementary approaches:

  • Complex I assembly analysis: Blue Native gel electrophoresis followed by in-gel activity assays or western blotting to assess incorporation into the mature complex.

  • Functional assessment of Complex I activity: Using techniques such as spectrophotometric assays of NADH:ubiquinone oxidoreductase activity or oxygen consumption measurements with the Extracellular Flux Analyzer.

  • Mitochondrial membrane potential (ΔΨm) measurements: Using potentiometric dyes like TMRM or JC-1 to assess the functional impact on proton pumping.

  • ATP production assays: Measuring changes in cellular ATP levels to determine the functional outcome of recombinant protein expression.

Studies have shown that successful integration of recombinant MT-ND6 can increase Complex I assembly and activity by 20-23%, resulting in approximately 53% increases in mitochondrial ATP levels and 33% improvements in ΔΨm in cells with mutated endogenous MT-ND6 .

What controls should be included when evaluating MT-ND6 expression systems?

When evaluating MT-ND6 expression systems, the following controls are essential:

  • Wild-type cells: Cells without mitochondrial mutations to establish baseline mitochondrial function.

  • Empty vector controls: Cells transfected with the expression vector lacking the MT-ND6 insert to account for vector-related effects.

  • Inactive MT-ND6 variant: Expression of a non-functional MT-ND6 variant to distinguish between specific protein effects and general effects of overexpression.

  • Tissue-specific controls: When studying disease models, both affected tissue and unaffected "distal" tissue should be analyzed, as demonstrated in hepatocellular carcinoma studies .

An important observation from studies of MT-ND6 expression is that overexpression in wild-type cells does not further increase protein levels, suggesting the existence of a maximum threshold level for maintaining normal function .

What methodologies are most effective for studying MT-ND6 mutations and their impact on Complex I function?

A multi-faceted approach is recommended for studying MT-ND6 mutations:

  • Genetic analysis: Next-generation sequencing of mitochondrial DNA to identify mutations, followed by heteroplasmy quantification.

  • Protein expression analysis: Western blotting using both N-terminal and C-terminal antibodies to detect potential truncated forms .

  • Biochemical assessment: Blue Native PAGE combined with activity staining to evaluate Complex I assembly and function .

  • Molecular dynamics simulations: Computational modeling to predict structural changes and stability impacts of mutations .

  • Functional assays: Measurements of ROS production, ATP synthesis, and membrane potential to assess functional consequences.

The combination of experimental and computational approaches provides robust evidence for the impact of mutations. For example, in studies of a truncated ND6 (ΔND6), molecular dynamics simulations revealed that the mutant protein undergoes conformational rearrangements rather than complete unfolding, resulting in a modified but relatively stable structure that negatively interacts with Complex I .

How can researchers differentiate between pathogenic and non-pathogenic variants of MT-ND6?

Differentiating pathogenic from non-pathogenic variants requires multiple lines of evidence:

Analytical ApproachPathogenic IndicatorsNon-pathogenic Indicators
Evolutionary ConservationAffects highly conserved residuesAffects variable regions
Structural AnalysisDisrupts critical protein-protein interactionsLocated in non-essential regions
Functional AssaysReduces Complex I activity by >20%Minimal impact on Complex I activity
ROS ProductionSignificantly increasedUnchanged or minimal increase
Clinical CorrelationAssociated with clear disease phenotypeFound in healthy individuals
Molecular DynamicsShows major conformational changesShows minimal structural impact

For example, the m.14484T>C mutation in human MT-ND6 causes Leber's hereditary optic neuropathy (LHON) and has been definitively classified as pathogenic based on its significant impact on Complex I function, increased ROS production, and strong association with disease .

What is the relationship between MT-ND6 mutations and mitochondrial disease pathogenesis?

MT-ND6 mutations contribute to disease pathogenesis through multiple interconnected mechanisms:

  • Disruption of Complex I assembly and activity: Mutations can reduce Complex I integration and electron transport efficiency, as demonstrated in studies showing 20-23% decreases in Complex I assembly and activity in cells with LHON-associated mutations .

  • Bioenergetic deficiency: Reduced ATP production (demonstrated decreases of ~53%) and diminished mitochondrial membrane potential (~33% reduction) impair cellular energy homeostasis .

  • Oxidative stress: Increased production of reactive oxygen species (ROS) creates a vicious cycle of oxidative damage to mitochondrial proteins, lipids, and mtDNA .

  • Dysregulated apoptosis: MT-ND6 mutations can promote apoptosis through increased cytochrome c release and activation of caspases 3, 7, and 9 .

  • Impaired mitophagy: Mutations can disrupt normal mitochondrial quality control processes, as evidenced by reduced levels of mitophagy markers like LC3II/I+II, P62, PINK1, and Parkin .

These pathogenic mechanisms have been extensively documented in LHON associated with the m.14484T>C mutation and in hepatocellular carcinoma associated with a novel truncating mutation of MT-ND6 .

How can allotopic expression of MT-ND6 be optimized for mitochondrial gene therapy?

Optimization of allotopic expression for MT-ND6 gene therapy requires addressing several technical challenges:

  • Codon optimization: All mitochondrial-specific codons must be replaced with universal genetic code equivalents while maintaining protein functionality .

  • Import efficiency: The mitochondrial targeting sequence must be optimized for efficient import. The COX8 targeting sequence has shown promising results in experimental models .

  • Expression level control: Stable, controlled expression is crucial, as studies have shown that there appears to be a maximum threshold level of MT-ND6 in wild-type cells .

  • Delivery system: Development of efficient delivery vectors that can reach affected tissues, particularly for neurodegenerative conditions like LHON.

  • Heteroplasmy management: The therapeutic approach must account for the coexistence of mutant and wild-type mtDNA in cells.

Research has demonstrated that allotopic expression of wild-type MT-ND6 can successfully restore Complex I deficiency, increase ATP production and membrane potential, reduce ROS production, inhibit apoptosis, and restore mitophagy in cells with the m.14484T>C mutation .

What techniques are most effective for studying MT-ND6 interactions within the mitochondrial respiratory chain?

Understanding MT-ND6 interactions requires sophisticated methodological approaches:

  • Cryo-electron microscopy: Provides high-resolution structural information about MT-ND6 within the assembled Complex I.

  • Crosslinking mass spectrometry: Identifies specific interaction partners and contact points between MT-ND6 and other Complex I subunits.

  • FRET-based proximity assays: Measures real-time interactions between fluorescently labeled MT-ND6 and other complex components.

  • Molecular dynamics simulations: Predicts conformational changes and interaction stability, as demonstrated in studies of truncated ND6 which showed that the protein undergoes conformational rearrangements rather than complete unfolding .

  • Co-immunoprecipitation: Identifies stable interaction partners of MT-ND6 within the respiratory complex.

Research has established that MT-ND6 is located at the junction between the P and Q modules of Complex I and plays a crucial role in creating the E-channel necessary for electron flow. The C-terminal region contains alpha helices involved in interactions with the Q module, and disruption of these interactions can destabilize the entire complex .

How can researchers effectively measure the impact of MT-ND6 variants on mitochondrial ROS production and oxidative stress?

A comprehensive approach to measuring ROS production and oxidative stress includes:

  • Flow cytometry with MitoSOX Red: Quantifies mitochondrial superoxide production with high sensitivity. This approach has been used to demonstrate that allotopic expression of wild-type MT-ND6 can reduce ROS levels in cells with pathogenic mutations .

  • Fluorescent probes: Various probes (DCF-DA, DHE, etc.) can measure different ROS species in live cells.

  • Antioxidant enzyme expression: Western blotting for SOD1, SOD2, and catalase provides insight into cellular responses to oxidative stress. Studies have shown that MT-ND6 mutations lead to increased expression of these enzymes, while restoration of normal MT-ND6 function reduces their levels .

  • Oxidative damage markers: Measurement of 8-oxo-dG (DNA damage), protein carbonylation (protein damage), and lipid peroxidation (membrane damage) provides a comprehensive assessment of oxidative damage.

  • Real-time monitoring: Using genetically encoded redox-sensitive probes (roGFP, HyPer, etc.) enables temporal analysis of ROS production.

Research has demonstrated that the m.14484T>C mutation in MT-ND6 leads to significantly increased ROS production, and that this can be reversed through allotopic expression of wild-type MT-ND6, providing a potential therapeutic approach for LHON .

How does P. ornatipinnis MT-ND6 compare structurally and functionally with human MT-ND6?

Comparative analysis reveals both similarities and differences between P. ornatipinnis and human MT-ND6:

FeatureP. ornatipinnis MT-ND6Human MT-ND6Significance
Protein LengthSimilar to human (100-115 aa)174 amino acidsConservation of core functional domains
Transmembrane DomainsMultiple hydrophobic segments5 transmembrane helicesSimilar structural organization
E-channel FormationConserved residuesWell-characterizedFunctional conservation
C-terminal RegionSome sequence divergenceCritical for complex assemblySpecies-specific adaptations
Codon UsageMitochondrial genetic codeMitochondrial genetic codeSimilar expression challenges

While the core functional elements are conserved, species-specific differences may reflect evolutionary adaptations to different metabolic demands and environmental conditions. The comparative study of P. ornatipinnis MT-ND6 provides insights into the evolutionary conservation of this essential mitochondrial component .

What can comparative studies of MT-ND6 across species reveal about mitochondrial evolution?

Comparative studies of MT-ND6 across species provide valuable insights into mitochondrial evolution:

  • Functional constraints: Highly conserved regions indicate essential functional domains under strong evolutionary selection.

  • Adaptive evolution: Variations in less constrained regions may reflect adaptations to specific metabolic requirements or environmental conditions.

  • Co-evolution patterns: Correlations between changes in MT-ND6 and other mitochondrial or nuclear-encoded Complex I subunits reveal co-evolutionary relationships.

  • E-channel conservation: The conservation of residues involved in creating the E-channel highlights the fundamental importance of this feature across evolutionary diverse species .

  • Disease-associated regions: Mapping disease-causing mutations across species can identify universally critical functional domains.

The study of MT-ND6 across species, from ancient fish like P. ornatipinnis to humans, provides a unique window into the evolution of mitochondrial energy production systems and can inform our understanding of both basic biology and disease mechanisms .

How can CRISPR-based mitochondrial editing be applied to study MT-ND6 function?

While direct CRISPR editing of mitochondrial DNA has been challenging, recent advances offer promising approaches:

  • DdCBEs (DddA-derived cytosine base editors): This technique enables precise C-to-T conversions in mtDNA and could be applied to create specific MT-ND6 variants.

  • Mitochondrial-targeted TALENs: These can be used to shift heteroplasmy levels of MT-ND6 mutations to study threshold effects.

  • Import of engineered RNA: Importing guide RNAs into mitochondria using specialized delivery systems could expand CRISPR applications.

  • Nuclear expression of edited MT-ND6: As an alternative to direct mtDNA editing, nuclear expression of edited MT-ND6 genes (allotopic expression) provides a way to study variant effects .

  • Mitochondrial-targeted restriction endonucleases: These can selectively eliminate mutant mtDNA in heteroplasmic cells.

These approaches would allow for unprecedented precision in studying the functional consequences of specific MT-ND6 variants and could lead to therapeutic strategies for mitochondrial diseases like LHON .

What role does MT-ND6 play in mitochondrial-nuclear communication and retrograde signaling?

Emerging evidence suggests MT-ND6 influences mitochondrial-nuclear communication through several mechanisms:

  • ROS-mediated signaling: MT-ND6 mutations increase ROS production, which acts as a signaling molecule affecting nuclear gene expression. This has been documented in studies showing elevated antioxidant enzyme expression in cells with MT-ND6 mutations .

  • Energy status signaling: Reduced ATP production due to MT-ND6 dysfunction activates energy sensors like AMPK, affecting numerous cellular processes.

  • Mitochondrial stress response: MT-ND6 dysfunction triggers mitochondrial unfolded protein responses and integrated stress responses.

  • Apoptotic pathway regulation: MT-ND6 mutations influence the expression of apoptosis regulators like BAX and Bcl-xL, affecting cell survival decisions .

  • Mitophagy signaling: Altered MT-ND6 function affects PINK1/Parkin-mediated mitophagy and mitochondrial quality control processes .

Understanding these signaling pathways offers potential therapeutic targets for mitochondrial diseases and cancer associated with MT-ND6 mutations .

How can single-molecule techniques advance our understanding of MT-ND6 dynamics within Complex I?

Single-molecule approaches provide unprecedented insights into MT-ND6 dynamics:

  • Single-molecule FRET: Allows observation of conformational changes in MT-ND6 during electron transport, providing insights into the dynamic rearrangements that occur during Complex I function.

  • High-speed AFM: Enables visualization of topological changes in Complex I with MT-ND6 variants under different conditions.

  • Nanopore analysis: Can detect structural transitions in individual MT-ND6 proteins or complexes containing MT-ND6.

  • Single-molecule force spectroscopy: Measures the stability of MT-ND6 and its interactions within Complex I.

  • Super-resolution microscopy: Tracks the dynamics of MT-ND6 within mitochondria in living cells.

These techniques could reveal crucial insights into how MT-ND6 mutations affect the dynamics of Complex I assembly and function, potentially explaining why certain mutations have more severe phenotypic consequences than others .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.