Recombinant Polypterus sp. Cytochrome b (mt-cyb)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will accommodate your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate this to us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a final concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This can serve as a reference point for your own protocols.
Shelf Life
The shelf life of the protein depends on various factors, including storage conditions, buffer composition, temperature, and inherent protein stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
mt-cyb; cob; cytb; mtcyb; Cytochrome b; Complex III subunit 3; Complex III subunit III; Cytochrome b-c1 complex subunit 3; Ubiquinol-cytochrome-c reductase complex cytochrome b subunit; Fragment
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-100
Protein Length
full length protein
Species
Polypterus sp. (Bichir)
Target Names
Target Protein Sequence
MGSLLGLCLIVQIITGLFLAMHYVSDISSAFSSVAHICRDVNYGWLIRNFHANGASLFFI CIYLHIARGLYYGSYLYMETWNIGVILLLLTMMTAFVGYV
Uniprot No.

Target Background

Function
Cytochrome b (mt-cyb) is a component of the ubiquinol-cytochrome c reductase complex (complex III or cytochrome b-c1 complex) within the mitochondrial respiratory chain. This complex facilitates electron transfer from ubiquinol to cytochrome c, contributing to the generation of a proton gradient across the mitochondrial membrane. This gradient is subsequently used for ATP synthesis.
Protein Families
Cytochrome b family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the evolutionary significance of Polypterus cytochrome b?

Polypterus represents one of the oldest groups of bony fish, having retained a similar structure for up to 100 million years . The cytochrome b gene (mt-cyb) in Polypterus is of particular evolutionary interest as it provides insights into the ancient establishment of the vertebrate mitochondrial gene order. The complete mitochondrial genome of Polypterus ornutipinnis demonstrates that the orientation and relative position of all genes is identical to the vertebrate consensus mitochondrial gene order, documenting the early establishment of this genomic organization . As a basal ray-finned fish, studying Polypterus mt-cyb offers a window into the ancestral state of this essential respiratory protein.

What are the recommended protocols for cloning and expressing Polypterus mt-cyb?

Based on established methods for mitochondrial genes, a robust protocol for Polypterus mt-cyb would include:

  • Isolation of mitochondrial DNA from fresh Polypterus tissue (liver or kidney) using differential centrifugation (1,000 × g to remove nuclei followed by 10,000 × g to pellet mitochondria) and standard alkaline lysis

  • PCR amplification of the mt-cyb gene using specific primers designed based on the known sequence

  • Cloning into an appropriate expression vector (such as pCRscript) via blunt-end cloning

  • Verification of the sequence and orientation

  • Transfer to an expression host such as yeast with its endogenous mt-cyb gene deleted

  • Expression confirmation through Western blotting and functional assays

For mitochondrial transformation in yeast models, microprojectile bombardment has proven effective, allowing for homoplasmic expression (containing only the introduced mtDNA population) .

What challenges are specific to producing functional recombinant Polypterus mt-cyb?

Producing functional recombinant cytochrome b presents several technical challenges:

  • As a highly hydrophobic membrane protein, proper folding and integration into mitochondrial membranes is critical

  • The protein functions as part of multi-subunit complex III, requiring appropriate assembly with other subunits

  • Proper incorporation of heme groups is essential for electron transport function

  • Expression systems must support mitochondrial targeting and assembly

To overcome these challenges, researchers should consider yeast expression systems that have been successfully used for human mt-cyb variants . These systems allow for the introduction of specific mutations and assessment of their functional consequences through established assays for complex III activity.

What approaches can be used to identify functionally significant domains in Polypterus mt-cyb?

To identify functionally significant domains in Polypterus mt-cyb, researchers should implement a multi-faceted approach:

  • Comparative sequence analysis with other vertebrate cytochrome b sequences to identify conserved regions

  • Structural modeling based on known cytochrome b structures

  • Systematic site-directed mutagenesis of conserved residues

  • Functional characterization of mutants using enzymatic assays

  • Inhibitor binding studies to identify catalytic and binding domains

Studies of human mt-cyb have identified critical functional domains such as the Qi site (involving residue p.Phe18) and Qo site (near residue p.Asp171) . Similar functionally important sites likely exist in Polypterus mt-cyb and can be identified through comparative analysis and targeted mutagenesis.

How can researchers best analyze single nucleotide polymorphisms (SNPs) in Polypterus mt-cyb?

Analysis of SNPs in Polypterus mt-cyb should follow a systematic workflow:

  • PCR amplification of the target sequence followed by Sanger sequencing or next-generation sequencing

  • Alignment with reference sequences to identify variants

  • Classification of variants as synonymous or non-synonymous

  • Assessment of conservation across species

  • Functional characterization through recombinant expression and biochemical assays

In studies of human MT-CYB, direct sequencing identified 13 SNPs, with eight non-synonymous variants and five synonymous variants . Similar approaches can be applied to Polypterus populations to assess natural variation in mt-cyb sequences and potential functional implications.

What assays are most effective for measuring recombinant Polypterus mt-cyb activity?

For comprehensive functional characterization of recombinant Polypterus mt-cyb, researchers should employ multiple complementary assays:

  • Cytochrome c Reduction Assay: Measures electron transfer from ubiquinol to cytochrome c, reflecting the core function of cytochrome b in complex III

  • Inhibitor Titration: Determines IC50 values for specific inhibitors, providing insights into binding site properties

  • Respiratory Growth Assays: Measures cell growth in media with increasing drug concentrations to assess in vivo respiratory function

  • Spectroscopic Analysis: Examines absorption spectra of heme groups to confirm proper incorporation and folding

  • Oxygen Consumption Measurements: Quantifies respiratory capacity in intact cells or isolated mitochondria

These assays should be performed with appropriate controls, including wild-type proteins and known functional variants, to provide robust characterization of recombinant Polypterus mt-cyb.

How can researchers assess the impact of mutations on Polypterus mt-cyb function?

To rigorously assess mutation effects on Polypterus mt-cyb function:

  • Generate a panel of mutations through site-directed mutagenesis, focusing on:

    • Conserved residues identified through sequence alignment

    • Residues corresponding to known functional domains in other species

    • Naturally occurring variants identified in Polypterus populations

  • Express mutant proteins in a suitable host system (e.g., yeast)

  • Perform functional assays comparing wild-type and mutant proteins:

    • Measure cytochrome c reduction activity with standardized protocols

    • Determine sensitivity to specific inhibitors

    • Assess respiratory growth under various conditions

  • Analyze data using appropriate statistical methods to identify significant functional changes

This approach has successfully revealed functional impacts of human mt-cyb variants, including altered drug sensitivity, as seen with the p.Phe18Leu variant increasing sensitivity to clomipramine and p.Asp171Asn enhancing sensitivity to atovaquone .

How can recombinant Polypterus mt-cyb contribute to understanding mitochondrial evolution?

Recombinant Polypterus mt-cyb offers unique opportunities for evolutionary studies:

  • As a representative of an ancient vertebrate lineage, Polypterus mt-cyb provides a reference point for tracking evolutionary changes in cytochrome b structure and function

  • Comparison with cytochrome b from other vertebrate groups can identify conserved features essential for respiratory function

  • Functional analysis of equivalent mutations across species can reveal evolutionary constraints on sequence divergence

  • Studying catalytic properties and inhibitor interactions can identify potential adaptations in respiratory metabolism

The placement of Polypterus in vertebrate phylogeny has been debated, with bichirs variously aligned with ray-finned fish (Actinopterygii), lobe-finned fish (Sarcopterygii), or placed in their own group (Brachiopterygii) . Functional studies of recombinant mt-cyb can provide additional data to resolve these phylogenetic questions.

What can comparative studies of Polypterus and human cytochrome b reveal about protein function conservation?

Comparative studies between Polypterus and human cytochrome b can reveal:

  • Conservation of catalytic mechanisms across 400+ million years of evolutionary divergence

  • Identification of structurally invariant residues essential for function

  • Lineage-specific adaptations in respiratory proteins

  • Evolutionary context for interpreting human disease-associated mutations

For example, studies of human mt-cyb variants in yeast have demonstrated that seemingly "silent" mutations can significantly modify complex III properties . Similar studies with Polypterus mt-cyb could identify whether such sensitivity to subtle sequence changes is an ancestral feature or derived characteristic of mammalian cytochrome b.

How can Polypterus mt-cyb studies inform our understanding of human mitochondrial diseases?

Polypterus mt-cyb research can provide valuable insights into human mitochondrial diseases through:

  • Evolutionary context for interpreting pathogenic mutations in human MT-CYB

  • Identification of functionally critical residues that may be targets for disease-causing mutations

  • Alternative model systems for studying mitochondrial dysfunction

  • Comparative analysis of complex III assembly and stability

Mutations in human MT-CYB have been associated with various clinical conditions, including isolated mitochondrial myopathy, exercise intolerance, multisystem disorders, and MELAS-like syndromes . The novel mutation m.14864T>C, which changes a highly conserved cysteine to arginine at position 40, was found in a patient with migraines, epilepsy, sensorimotor neuropathy, and strokelike episodes . Studying equivalent positions in Polypterus mt-cyb could help determine the evolutionary conservation of these disease-associated residues.

What potential does recombinant Polypterus mt-cyb hold for drug discovery research?

Recombinant Polypterus mt-cyb offers several advantages for drug discovery applications:

  • Provides an alternative model for screening compounds targeting complex III

  • Allows comparative analysis of drug binding sites across evolutionary distance

  • Can help identify conserved binding pockets for rational drug design

  • Enables testing of species-specific drug interactions

Human mt-cyb variants show differential sensitivity to therapeutic compounds, with variants at position 18 affecting sensitivity to the antidepressant clomipramine and variants at position 171 altering sensitivity to the antimalarial atovaquone . Similar studies with Polypterus mt-cyb could identify evolutionarily conserved drug binding sites that might represent optimal targets for therapeutic development.

What are the best methodologies for studying Polypterus mt-cyb interaction with other complex III components?

To investigate interactions between recombinant Polypterus mt-cyb and other complex III components:

  • Co-expression systems: Express Polypterus mt-cyb alongside other complex III subunits in suitable host organisms

  • Blue native PAGE: Analyze intact complex assembly and stability

  • Chemical cross-linking coupled with mass spectrometry: Identify specific interaction points between subunits

  • Proximity labeling: Map the interaction landscape within the assembled complex

  • Cryo-electron microscopy: Determine the three-dimensional structure of the assembled complex

These approaches can reveal how Polypterus mt-cyb integrates into complex III and whether there are unique structural features compared to mammalian systems.

How can researchers effectively measure the impact of Polypterus mt-cyb variants on reactive oxygen species production?

Mitochondrial complex III is a known site of reactive oxygen species (ROS) production, and cytochrome b mutations can potentially alter this process. To assess ROS production:

  • Express wild-type and variant Polypterus mt-cyb in appropriate host cells

  • Utilize fluorescent probes specific for superoxide (e.g., MitoSOX) or hydrogen peroxide (e.g., Amplex Red)

  • Measure ROS production under basal conditions and with specific complex III inhibitors

  • Correlate ROS production with electron transport activity and complex assembly

  • Assess downstream effects on cellular antioxidant systems and oxidative damage markers

This approach can identify whether specific variants increase oxidative stress, potentially linking to mechanisms of mitochondrial dysfunction.

What are effective strategies for optimizing recombinant Polypterus mt-cyb expression?

Optimizing expression of recombinant Polypterus mt-cyb requires attention to several factors:

  • Codon optimization: Adjust codons to match host organism preferences

  • Promoter selection: Use promoters appropriate for mitochondrial protein expression

  • Expression conditions: Optimize temperature, induction timing, and media composition

  • Solubilization methods: Select appropriate detergents for membrane protein extraction

  • Purification strategies: Implement affinity tags that don't interfere with protein function

For yeast expression systems, the use of respiratory-deficient strains lacking endogenous cytochrome b provides a clean background for functional studies , while biolistic transformation methods have proven effective for introducing exogenous mtDNA .

What quality control measures are essential for verifying recombinant Polypterus mt-cyb integrity?

Comprehensive quality control for recombinant Polypterus mt-cyb should include:

  • Sequence verification: Confirm the absence of unwanted mutations

  • Expression level assessment: Quantify protein yield through Western blotting

  • Purity analysis: Ensure absence of contaminating proteins through SDS-PAGE

  • Functional validation: Verify activity through cytochrome c reduction assays

  • Spectroscopic characterization: Confirm proper heme incorporation through absorption spectra

  • Homoplasmy verification: Ensure complete replacement of endogenous mt-cyb in mitochondrial expression systems

These measures will ensure that experimental results accurately reflect the properties of the recombinant protein rather than artifacts from expression or purification.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.