Recombinant Polystichum munitum Chlorophyll a-b binding protein type 1 member F3, chloroplastic (CABF3)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, provided for your reference.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CABF3; Chlorophyll a-b binding protein type 1 member F3, chloroplastic; Chlorophyll a-b binding protein type I F3; CAB-F3; LHCP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
37-265
Protein Length
Full Length of Mature Protein
Species
Polystichum munitum (Western swordfern) (Aspidium munitum)
Target Names
CABF3
Target Protein Sequence
MAPKSKAPSGSIWYGSDRPLYLGPFSGSPPSYLSGEFPGDYGWDTAGLSADPETFAKNRE LEVIHSRWAMLGALGCVTPELLAKNGVKFGEAVWFKAGSQIFAEGGLDYLGNPSLVHAQS ILAIWACQVILMGAVEGYRVAGGPLGEVEDPIYPGGSFDPLGLADDPEAFAELKVKELKN GRLAMFSMFGFFVQAIVTGKGPIENLSDHLADPAVNNAWAYATNFTPGK
Uniprot No.

Target Background

Function

The light-harvesting complex (LHC) functions as a light receptor, capturing and transferring excitation energy to associated photosystems.

Protein Families
Light-harvesting chlorophyll a/b-binding (LHC) protein family
Subcellular Location
Plastid, chloroplast thylakoid membrane; Multi-pass membrane protein.

Q&A

What is the genetic structure of the CABF3 gene in Polystichum munitum?

The CABF3 gene in Polystichum munitum is part of the CAB gene family that encodes chlorophyll a/b-binding proteins. Research has revealed that the majority of CAB gene sequences isolated from P. munitum represent defective genes, unlike in the genomes of diploid angiosperms where most CAB genes are functional . To characterize CABF3's structure, researchers constructed a genomic DNA library from P. munitum (n = 41) and screened it using probes derived from tomato CAB genes . Methodologically, this involves:

  • Isolation of nuclei using sucrose gradient centrifugation

  • DNA purification using cetyltrimethylammonium bromide treatment

  • Partial digestion of DNA with restriction endonuclease Sau3A1

  • Size fractionation by sucrose gradient centrifugation

  • Ligation to phage vector arms

  • Screening using low-stringency hybridization conditions with specific probes

This approach has enabled the identification and characterization of the CABF3 gene structure, revealing its sequence composition and potential functional elements.

How do researchers propagate Polystichum munitum for CAB protein studies?

Researchers cultivating P. munitum for protein studies must follow specific propagation protocols to ensure viable specimens. The recommended methodology includes:

  • Collect spores when mature (July to late August) by shaking fronds in a paper bag to capture released spores

  • Sow spores on sterilized media (3:1:1 soil, perlite, and coconut coir) pre-moistened with distilled water

  • Use fine sieve for even distribution of spores across the media surface

  • Maintain in high humidity environment (clear plastic containers) and water with distilled water only

  • After germination (30-60 days), monitor for development of prothalli (gametophyte generation)

  • Ensure sufficient moisture for fertilization

  • Transplant developing sporophytes when they have 1-2 true leaves

This propagation method provides researchers with a reliable source of plant material for protein extraction and analysis, though the complete cycle takes approximately 24 months before plants are fully established .

What extraction methods are most effective for isolating CABF3 proteins from Polystichum munitum?

Effective extraction of CABF3 proteins from P. munitum tissue requires a protocol that preserves protein structure while removing interfering compounds. The recommended methodology combines:

  • Cryogenic grinding of young frond tissue in liquid nitrogen

  • Extraction in buffer containing:

    • 50 mM Tris-HCl (pH 7.5)

    • 150 mM NaCl

    • 1 mM EDTA

    • 10% glycerol

    • 1 mM DTT

    • Protease inhibitor cocktail

  • Centrifugation at 15,000 × g for 20 minutes at 4°C

  • Ammonium sulfate precipitation (35-65% saturation)

  • Dialysis against buffer with reduced salt concentration

  • Purification using ion exchange chromatography

When characterizing extracted proteins, researchers typically employ electrophoretic techniques similar to those used in analyzing sperm nuclear basic proteins from P. munitum, including acetic acid-urea PAGE and SDS-PAGE .

How do researchers explain the presence of multiple defective CAB genes in Polystichum munitum and what implications does this have for CABF3?

The presence of multiple defective CAB genes in Polystichum munitum presents a unique research opportunity. Three primary hypotheses have been proposed :

HypothesisDescriptionMethodological Approach for Testing
Gene SilencingDefective CAB genes result from silencing after polyploidizationComparative genomic analysis with related fern species at different ploidy levels
No PolyploidizationP. munitum didn't undergo polyploidization, but CAB genes mutatedChromosome evolution studies and molecular clock analysis
Selective AmplificationSome defective CAB genes specifically amplified in the genomeQuantitative PCR to measure copy numbers of various CAB genes

To determine which hypothesis applies to CABF3 specifically, researchers should employ:

  • Gene expression analysis using RT-qPCR to determine if CABF3 is transcriptionally active

  • Promoter analysis to identify potential regulatory elements affecting expression

  • Phylogenetic analysis comparing CABF3 sequences with those from other ferns and seed plants

  • Functional complementation studies in model organisms to test protein activity

Recent research suggests the gene silencing hypothesis may be most plausible, as enzyme electrophoretic investigations show that fern species with lower chromosome numbers have isozyme patterns typical of diploid seed plants, despite having no isozyme evidence for polyploidy .

What methodologies are most effective for characterizing the structure-function relationship of recombinant CABF3?

Investigating the structure-function relationship of recombinant CABF3 requires a comprehensive methodological approach:

  • Heterologous Expression Systems:

    • E. coli expression systems using pET vectors for high protein yield

    • Insect cell expression systems for proper folding and post-translational modifications

    • Plant-based expression systems for native-like processing

  • Structural Analysis:

    • X-ray crystallography of purified protein

    • Circular dichroism spectroscopy for secondary structure analysis

    • Nuclear magnetic resonance for solution structure determination

  • Functional Characterization:

    • Pigment binding assays to quantify chlorophyll a/b binding efficiency

    • Reconstitution experiments in liposomes to assess membrane integration

    • Energy transfer measurements using time-resolved fluorescence spectroscopy

  • Mutational Analysis:

    • Site-directed mutagenesis of conserved residues

    • Deletion analysis of protein domains

    • Chimeric protein construction to identify functional regions

When comparing functional data between wild-type and recombinant CABF3, researchers should carefully control for differences in post-translational modifications that may affect protein activity.

How can researchers address the contradictions between genomic and proteomic data in CABF3 studies?

Resolving contradictions between genomic and proteomic data for CABF3 requires a systematic approach:

  • Validation of Gene Models:

    • RNA-Seq to confirm actual transcripts produced

    • 5' and 3' RACE to define exact transcript boundaries

    • Analysis of alternative splicing patterns

  • Comprehensive Proteomic Analysis:

    • Multiple extraction methods to ensure complete protein coverage

    • Both top-down and bottom-up mass spectrometry approaches

    • Enrichment protocols for membrane proteins to improve detection

  • Integration of Multiple Data Types:

    • Correlation analysis between transcript and protein abundance

    • Consideration of post-transcriptional and post-translational regulation

    • Assessment of protein turnover rates using pulse-chase experiments

  • Biological Validation:

    • Immunolocalization to confirm protein presence and distribution

    • Functional assays to validate predicted protein activity

    • In vitro translation experiments to test if defective genes can produce proteins

A key challenge stems from the fact that many CAB genes in P. munitum are potentially defective yet may still be transcribed . Researchers should employ ribosome profiling to determine which transcripts are actually translated into proteins.

What are the optimal conditions for expressing recombinant CABF3 in heterologous systems?

Optimizing expression of recombinant CABF3 requires careful consideration of several experimental parameters:

Expression SystemAdvantagesOptimal ConditionsExpected Yield
E. coliHigh yield, simple setupBL21(DE3) strain, 16°C induction, 0.1-0.5 mM IPTG, 16-24 hours5-10 mg/L
Insect cellsBetter folding, PTMsSf9 cells, MOI 5-10, harvest 72 hours post-infection1-5 mg/L
Plant expressionNative-like processingN. benthamiana, Agrobacterium infiltration, harvest 5-7 days post-infiltration50-200 μg/g fresh weight

For successful CABF3 expression:

  • Codon-optimize the sequence for the host organism

  • Include a purification tag (His6 or FLAG) separated by a TEV protease cleavage site

  • Consider fusion partners (MBP, GST, SUMO) to improve solubility

  • For membrane integration studies, include native transit peptide sequences

  • Supplement growth media with chlorophyll precursors (δ-aminolevulinic acid)

  • Extract under non-denaturing conditions using mild detergents (0.1% DDM or LMNG)

Expression levels should be monitored using western blot analysis with antibodies against the purification tag and, if available, the CABF3 protein itself .

What strategies can researchers use to investigate the evolutionary history of CABF3 in relation to other CAB proteins?

Investigating the evolutionary history of CABF3 requires a multifaceted approach:

  • Comprehensive Sequence Collection:

    • Obtain CAB sequences from diverse plant lineages, including ferns, gymnosperms, and angiosperms

    • Include both functional and potentially defective sequences

    • Use both genome mining and transcriptome sequencing for complete coverage

  • Phylogenetic Analysis:

    • Multiple sequence alignment using MUSCLE or MAFFT algorithms

    • Model testing to determine optimal evolutionary models (e.g., JTT, WAG, LG)

    • Tree building using Maximum Likelihood, Bayesian Inference, and Maximum Parsimony methods

    • Bootstrap analysis (>1000 replicates) to evaluate branch support

  • Molecular Evolution Analysis:

    • Calculate dN/dS ratios to detect selection pressure

    • Test for gene conversion events using GENECONV

    • Identify conserved motifs using MEME and other pattern recognition tools

    • Apply reconciliation methods to distinguish between speciation and duplication events

  • Synteny Analysis:

    • Compare genomic context of CAB genes across species

    • Identify conserved gene neighborhoods

    • Detect genome rearrangements affecting CAB gene evolution

This approach has revealed that P. munitum possesses multiple defective CAB genes, suggesting either gene silencing following polyploidy, mutations in the absence of polyploidization, or selective amplification of defective sequences .

How can researchers effectively study the role of CABF3 in photosynthetic efficiency under varying environmental conditions?

To investigate CABF3's role in photosynthetic efficiency across environmental conditions, researchers should implement:

  • Controlled Environment Experiments:

    • Grow P. munitum sporophytes under varying light intensities (50-1000 μmol photons m⁻² s⁻¹)

    • Test temperature ranges (10-30°C)

    • Manipulate humidity levels (40-90%)

    • Vary water availability to simulate drought conditions

  • Physiological Measurements:

    • Chlorophyll fluorescence (Fv/Fm, ΦPSII, NPQ) using PAM fluorometry

    • Gas exchange measurements (photosynthetic rate, transpiration)

    • Chlorophyll content determination

    • Reactive oxygen species quantification

  • Molecular Responses:

    • qRT-PCR to measure CABF3 transcript levels under different conditions

    • Western blotting to quantify protein abundance

    • Chromatin immunoprecipitation to identify transcription factors regulating CABF3

    • Protein-protein interaction studies to map changing associations

  • Comparative Approaches:

    • Analyze responses in ferns from different habitats

    • Compare with responses in angiosperms with fully functional CAB proteins

    • Assess performance in natural environments with fog exposure, as P. munitum has high foliar uptake capacity that allows it to rely on fog water during summer months in some habitats

For field studies, it's important to note that P. munitum occurs from sea level to mid-elevations in moist coniferous forests throughout its range , allowing for natural experiments across elevation gradients.

What are the key challenges in purifying active CABF3 protein and how can they be overcome?

Purifying active CABF3 presents several technical challenges that require specific methodological solutions:

ChallengeSolution
Membrane integrationUse mild detergents (DDM, LMNG) at critical micelle concentration
Protein instabilityInclude stabilizing agents (glycerol 10-20%, specific lipids)
Low expression levelsUtilize WGCNA analysis to identify optimal extraction timing
Pigment loss during purificationSupplement buffers with chlorophyll a and b
AggregationAdd low concentrations of arginine (50-100 mM) to buffers

A recommended purification protocol involves:

  • Solubilization with 1% digitonin or 1% DDM for 1 hour at 4°C

  • Clarification by ultracentrifugation (100,000 × g, 1 hour)

  • Affinity chromatography using immobilized metal affinity chromatography (IMAC)

  • Size exclusion chromatography in buffer containing 0.05% detergent

  • Verification of pigment binding using absorption spectroscopy (peaks at 440 and 675 nm)

During purification, researchers should monitor both protein purity and functional activity, as the latter can decrease even with high purity levels if the protein loses its associated pigments or undergoes conformational changes.

How can researchers effectively analyze defective versus functional CAB genes in the P. munitum genome?

Distinguishing between defective and functional CAB genes requires a systematic analytical approach:

  • Comprehensive Sequence Analysis:

    • Identify open reading frames and potential coding regions

    • Detect frameshifts, premature stop codons, and insertions/deletions

    • Compare with known functional CAB genes from other species

    • Analyze splice site integrity for proper intron processing

  • Transcriptional Analysis:

    • Perform RNA-Seq to identify which genes are transcribed

    • Use 5' RACE to map transcription start sites

    • Employ 3' RACE to identify polyadenylation sites

    • Analyze splicing patterns using RT-PCR and isoform sequencing

  • Translational Assessment:

    • Perform ribosome profiling to determine which transcripts are translated

    • Conduct proteomics analysis to identify expressed protein products

    • Develop specific antibodies to detect individual CAB proteins

    • Use in vitro translation systems to test coding capacity

  • Functional Characterization:

    • Express predicted functional and defective genes in heterologous systems

    • Assess chlorophyll binding capacity

    • Measure integration into photosynthetic complexes

    • Evaluate energy transfer efficiency

This comprehensive approach will allow researchers to understand the full spectrum of CAB genes in P. munitum, where the majority of sequences isolated and characterized represent defective genes .

What computational tools and algorithms are most appropriate for predicting the structure and function of CABF3?

For predicting CABF3 structure and function, researchers should employ a combination of computational tools:

The computational tools should be selected based on CABF3's relationship to other CAB proteins, accounting for its potentially unique features as a fern protein with possible defective characteristics.

What emerging technologies show promise for advancing our understanding of CABF3 functionality?

Several cutting-edge technologies offer significant potential for CABF3 research:

  • Cryo-Electron Microscopy:

    • High-resolution structural determination of membrane-integrated CABF3

    • Visualization of CABF3 within native photosynthetic complexes

    • Analysis of conformational changes under different conditions

  • Single-Molecule Techniques:

    • Förster Resonance Energy Transfer (FRET) to measure protein dynamics

    • Atomic Force Microscopy for topographical mapping

    • Optical tweezers to measure protein-protein interaction forces

  • Advanced Genetic Manipulation:

    • CRISPR-Cas9 genome editing in fern gametophytes

    • Targeted mutagenesis of CABF3 in its native context

    • Development of fern-specific expression systems

  • Integrative Omics:

    • Multi-omics approaches combining genomics, transcriptomics, proteomics, and metabolomics

    • Spatial transcriptomics to map gene expression across tissue types

    • Single-cell analysis of photosynthetic cells

  • Computational Advances:

    • Quantum computing for modeling complex energy transfer processes

    • Machine learning for predicting protein-pigment interactions

    • Systems biology approaches to model photosynthetic networks

These technologies would help address fundamental questions about CABF3's role in the unique evolutionary context of ferns, where many CAB genes have become defective while some remain functional .

How might understanding CABF3 contribute to broader knowledge of photosynthetic adaptation in non-seed plants?

Research on CABF3 has significant implications for understanding photosynthetic adaptation in non-seed plants:

  • Evolutionary Insights:

    • Clarifies the trajectory of photosynthetic protein evolution across plant lineages

    • Illuminates how genome duplications influence photosynthetic gene families

    • Provides context for understanding the persistence of defective genes alongside functional ones

  • Stress Adaptation Mechanisms:

    • Reveals how ferns maintain photosynthetic efficiency in deep shade environments

    • Elucidates mechanisms for managing light stress in variable understory conditions

    • Identifies unique adaptations in foliar water uptake capacity, which varies with latitude in some fern habitats

  • Genome-to-Phenotype Relationships:

    • Demonstrates how genetic variations translate to functional differences in photosynthesis

    • Illuminates compensatory mechanisms that maintain photosynthetic function despite gene defects

    • Provides insights into the minimum genetic requirements for efficient photosynthesis

  • Developmental Biology:

    • Clarifies protein expression patterns during the transition from gametophyte to sporophyte

    • Identifies regulatory networks controlling photosynthetic protein expression

    • Reveals how light signaling pathways evolved in ferns compared to seed plants

The study of CABF3 in P. munitum is particularly valuable because this species grows in diverse habitats from sea level to mid-elevations , providing natural experimental conditions for studying photosynthetic adaptation across environmental gradients.

What interdisciplinary approaches might yield the most significant insights into CABF3 biology?

Advancing CABF3 research requires integration across multiple disciplines:

  • Evolutionary Biology + Structural Biology:

    • Reconstruct ancestral CAB proteins to understand evolutionary trajectories

    • Determine how structural changes affected function throughout evolution

    • Identify conserved regions essential for photosynthetic function

  • Ecology + Genomics:

    • Sample P. munitum populations across environmental gradients for comparative genomics

    • Correlate genetic variations with ecological parameters

    • Identify selective pressures driving CABF3 evolution in different habitats

  • Biophysics + Computational Biology:

    • Model energy transfer processes in functioning versus defective CAB proteins

    • Simulate chlorophyll-protein interactions under different light conditions

    • Predict optimal protein configurations for various environmental conditions

  • Plant Physiology + Molecular Biology:

    • Measure photosynthetic parameters in plants with varying CABF3 expression

    • Develop transgenic models to test functional hypotheses

    • Compare physiological responses across fern species with different CAB gene complements

  • Paleobotany + Genomics:

    • Analyze fossil evidence alongside molecular data to create temporal context

    • Reconstruct environment-genome interactions through evolutionary time

    • Identify key transitions in photosynthetic adaptation during fern evolution

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.