Recombinant Pongo abelii 1-acyl-sn-glycerol-3-phosphate acyltransferase delta (AGPAT4)

Shipped with Ice Packs
In Stock

Description

Biological Function and Enzyme Activity

AGPAT4 belongs to the acyltransferase family and operates at the endoplasmic reticulum and mitochondrial membranes . Its primary enzymatic role involves:

  • Substrate specificity: Transfers acyl groups to the sn-2 position of LPA to form PA .

  • Metabolic pathways: Integral to the Kennedy pathway for glycerophospholipid synthesis and TAG biosynthesis .

  • Tissue-specific roles: Studies in mice show AGPAT4 influences lipid storage in adipose tissue and phospholipid composition in the brain .

Key Functional Insights from Knockout Studies:

Observation in Agpat4<sup>−/−</sup> MiceTissue AffectedImplications
40% increase in epididymal WAT massWhite adipose tissue (WAT)AGPAT4 regulates adipocyte lipid storage
50% reduction in brain phosphatidylinositol (PI)BrainSupports PI synthesis via mitochondrial pathways
Compensatory upregulation of Agpat1/3/5Perirenal WATFunctional redundancy among AGPAT isoforms

Recombinant Protein Production

Commercially available recombinant AGPAT4 is produced in bacterial expression systems:

Lipid Metabolism Studies

  • Adipose tissue dynamics: AGPAT4 deficiency in mice increases TAG content in epididymal WAT, linked to reduced lipolysis and altered adipocyte size .

  • Brain phospholipids: AGPAT4 supports phosphatidylcholine (PC) and phosphatidylethanolamine (PE) synthesis, critical for neuronal membrane integrity .

Regulatory Mechanisms

  • Transcriptional control: Cardiac AGPAT4 activity is modulated by PPARα, influencing lipid oxidation pathways .

  • Compensatory upregulation: Loss of AGPAT4 triggers isoform-specific redundancy (e.g., AGPAT3 in brain) .

Implications for Disease Models

AGPAT4’s role in lipid homeostasis positions it as a potential target for:

  • Metabolic disorders: Dysregulation linked to adipose tissue expansion and insulin resistance .

  • Neurological conditions: Altered PI/PC levels associated with neuroinflammation and mitochondrial dysfunction .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. For the lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C, and aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
AGPAT4; 1-acyl-sn-glycerol-3-phosphate acyltransferase delta; 1-acylglycerol-3-phosphate O-acyltransferase 4; 1-AGP acyltransferase 4; 1-AGPAT 4; Lysophosphatidic acid acyltransferase delta; LPAAT-delta
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-378
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
MDLAGLLKSQFLCHLVFCYVFIASGLIINTIQLFTLLLWPINKQLFRKINCRLSYCISSQ LVMLLEWWSGTECTIFTDPRAYLKYGKENAIVVLNHKFEIDFLCGWSLSERFGLLGGSKV LAKKELAYVPIIGWMWYFTEMVFCSRKWEQDRKTVATSLQHLRDYPEKYFFLIHCEGTRF TEKKHEISMQVARAKGLPRLKHHLLPRTKGFAITVRSLRNVVSAVYDCTLNFRNNENPTL LGVLNGKKYHADLYVRRIPLEDIPEDDDECSAWLHKLYQEKDAFQEEYYRTGTFPETPMV PPRRPWTLVNWLFWASLVLYPFFQFLVSMIRSGSSLTLASFILVFFVASVGVRWMIGVTE IDKGSAYGNSGSKQKLND
Uniprot No.

Target Background

Function
Converts 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. Exhibits high acyl-CoA specificity for polyunsaturated fatty acyl-CoA, particularly docosahexaenoyl-CoA (22:6-CoA, DHA-CoA).
Database Links
Protein Families
1-acyl-sn-glycerol-3-phosphate acyltransferase family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the fundamental role of AGPAT4 in phospholipid biosynthesis and how does the Pongo abelii variant compare to human AGPAT4?

AGPAT4 (1-acylglycerol-3-phosphate O-acyltransferase 4) catalyzes the acylation of lysophosphatidic acid (LPA) to produce phosphatidic acid (PA), representing the second step in de novo phospholipid biosynthesis . This conversion is critical for membrane glycerophospholipid production across species.

The Pongo abelii (Sumatran orangutan) AGPAT4 shares significant sequence homology with human AGPAT4, but contains species-specific amino acid variations that may affect substrate specificity and enzyme kinetics. Comparative analysis between recombinant human and Pongo abelii AGPAT4 reveals:

FeatureHuman AGPAT4Pongo abelii AGPAT4
Amino acid sequence identityReference~97-98% homology to human
Substrate preferenceDiverse acyl-CoA donorsPossible preference for specific polyunsaturated fatty acyl donors
Subcellular localizationMitochondrialPresumed mitochondrial (based on sequence conservation)
Tissue expressionHighest in brainPredicted highest in brain (based on evolutionary conservation)

Methodological approach: To investigate functional differences, researchers should perform side-by-side enzymatic assays using purified recombinant proteins from both species with various acyl-CoA donors and measure product formation via liquid chromatography-mass spectrometry (LC-MS) .

What expression patterns does AGPAT4 demonstrate during development, and what methodologies are recommended for studying these patterns?

Studies in murine models demonstrate that AGPAT4 exhibits significant temporal regulation during embryonic development . Research shows:

  • AGPAT4 is upregulated 3.7-fold at embryonic day E14.5 compared to E10.5

  • Expression dramatically decreases to only 4% of E14.5 levels by E18.5 (immediately prior to birth)

  • AGPAT4 is immunodetectable in both cortical neurons and glial cells derived from developing mouse brain

This temporal expression pattern suggests AGPAT4 may play a critical role during specific developmental windows, particularly during mid-embryonic development when neural differentiation is prominent.

Recommended methodological approaches:

  • RT-qPCR with appropriate reference genes (e.g., 18S rRNA) for temporal expression analysis across developmental timepoints

  • Immunohistochemistry with cell-type specific markers (e.g., NESTIN for neurons, GFAP for glial cells) for cellular localization studies

  • In situ hybridization to visualize tissue-specific expression patterns

  • Conditional knockout models to investigate developmental stage-specific functions

For non-human primates like Pongo abelii, where direct embryonic studies face ethical limitations, researchers should consider post-mortem tissue analysis or induced pluripotent stem cell (iPSC) models that can recapitulate developmental trajectories.

What are the optimal conditions for solubilizing and purifying active recombinant AGPAT4 from Pongo abelii?

AGPAT4 presents significant purification challenges as an integral membrane protein. Standard purification protocols often result in loss of enzymatic activity, which has historically hampered biochemical characterization . Based on successful protocols with related enzymes:

ParameterRecommended ConditionRationale
Expression systemE. coli (most common) Balances protein yield with proper folding
Solubilization detergent6-cyclohexyl-1-hexyl-β-d-maltosidePreserves enzymatic activity better than harsher detergents
Buffer compositionTris-based buffer with 50% glycerolStabilizes protein during storage
Storage temperature-20°C/-80°CExtended shelf life (6 months liquid, 12 months lyophilized)
ReconstitutionDeionized sterile water to 0.1-1.0 mg/mLOptimal concentration for activity assays
Purity confirmationSDS-PAGE (>85% purity)Standard for recombinant protein quality control

Methodological considerations:

  • Avoid repeated freeze-thaw cycles, which significantly reduce enzymatic activity

  • Store working aliquots at 4°C for no longer than one week

  • Consider adding protease inhibitors during purification to prevent degradation

  • Validate enzymatic activity immediately after purification using appropriate substrates

Advanced researchers should consider using nanodiscs or liposome reconstitution systems to maintain the protein in a more native membrane environment, which may better preserve activity for functional studies.

How does AGPAT4 contribute to phospholipid metabolism in neuronal tissue, and what experimental approaches best elucidate its function?

AGPAT4 demonstrates notably high expression in brain tissue compared to other organs, suggesting a specialized role in neural phospholipid metabolism . Research findings indicate:

  • AGPAT4 is localized to mitochondria in neurons, with a distinct punctate staining pattern observable via immunofluorescence

  • It is present in both neurons (co-localizing with NESTIN or Nissl stain) and glial cells (co-localizing with GFAP)

  • Its temporal regulation during development suggests involvement in critical periods of neural membrane expansion and/or remodeling

Recommended experimental approaches:

ApproachApplicationExpected Outcome
Subcellular fractionationConfirm mitochondrial localizationEnrichment in mitochondrial fraction
Lipidomics analysisIdentify altered phospholipid species in AGPAT4-deficient cellsChanges in phosphatidic acid species profile
Neurite outgrowth assaysAssess role in membrane expansionAltered neurite length or branching patterns
ElectrophysiologyEvaluate membrane functional propertiesChanges in synaptic transmission parameters
CRISPR-Cas9 knockoutDetermine essentiality in neuronsViability and functional consequences

For studies specifically focused on Pongo abelii AGPAT4, researchers should consider comparative analyses between human and orangutan iPSC-derived neural cultures to identify species-specific functions in neuronal development and maintenance.

What is the role of AGPAT4 in regulating immune responses in the tumor microenvironment?

Recent research has uncovered a surprising role for AGPAT4 in modulating immune responses within the tumor microenvironment, particularly in colorectal cancer (CRC) . Key findings include:

  • AGPAT4 is aberrantly expressed in colorectal cancer tissues compared to normal tissues

  • AGPAT4 expression levels correlate with poor survival in CRC patients

  • While AGPAT4 manipulation doesn't affect CRC cell growth in vitro, silencing AGPAT4 suppresses tumor growth in xenograft models

  • Mechanistically, AGPAT4 silencing induces LPA release from CRC cells, which polarizes macrophages toward an anti-tumor M1-like phenotype through LPA receptors 1 and 3

  • This M1 activation is characterized by elevated p38/p65 signaling and increased proinflammatory cytokines

  • The resulting inflammatory environment promotes CD4+ and CD8+ T cell infiltration and activation

Methodological approaches to investigate this pathway:

ApproachPurposeKey Parameters
AGPAT4 knockdown/overexpressionModulate enzyme levelssiRNA, shRNA, or CRISPR-Cas9 systems
Co-culture systemsStudy cancer cell-macrophage interactionsTranswell or direct co-culture conditions
Flow cytometryAnalyze immune cell polarizationM1 markers (CD45+F4/80+CD11c+) vs. M2 markers (CD45+F4/80+CD206+)
Cytokine profilingMeasure inflammatory mediatorsIL-1β, IL-6, TNFα (M1) vs. IL-10, Arg-1 (M2)
Western blottingAssess signaling pathway activationPhosphorylated p38 and p65 levels
LPA measurementsQuantify LPA releaseLC-MS based lipidomics

While this function has been primarily characterized in human and mouse models, similar pathways likely exist in Pongo abelii. Comparative studies using recombinant Pongo abelii AGPAT4 could reveal evolutionary differences in immune modulation across primate species.

What evolutionary insights can be gained from studying Pongo abelii AGPAT4 in comparison to human and other primate AGPAT4 variants?

Evolutionary analysis of AGPAT4 across primate species offers valuable insights into the conservation and divergence of phospholipid metabolism pathways. Pongo abelii (Sumatran orangutan) represents an important branch in primate evolution, having diverged from the human lineage approximately 12-16 million years ago.

Key evolutionary considerations:

  • Sequence conservation analysis reveals highly conserved catalytic domains across primates, suggesting functional importance

  • Species-specific variations predominantly occur in non-catalytic regions, potentially affecting regulatory interactions

  • Comparison of substrate preferences across species may reveal adaptive changes in membrane lipid composition

  • Differences in expression patterns may reflect species-specific metabolic adaptations

Methodological approaches:

ApproachApplicationExpected Outcome
Phylogenetic analysisTrace evolutionary historyEvolutionary rate and selective pressure metrics
Structural modelingPredict functional consequences of variantsIdentification of species-specific substrate binding determinants
Recombinant protein activity assaysCompare enzymatic parametersSpecies-specific differences in substrate affinity and catalytic efficiency
Genomic sequence analysisIdentify regulatory element differencesInsights into expression pattern divergence

The study of Pongo abelii AGPAT4 is particularly valuable for understanding primate-specific adaptations in phospholipid metabolism, potentially revealing how differences in membrane composition may have contributed to cognitive evolution and brain development across the primate lineage.

What technical considerations are important when designing activity assays for recombinant Pongo abelii AGPAT4?

Designing robust enzymatic assays for AGPAT4 requires careful consideration of multiple factors to ensure physiologically relevant results. Based on successful approaches with related enzymes:

ParameterRecommendationRationale
Substrate preparationUse freshly prepared or carefully stored lysophosphatidic acidLPA is prone to degradation
Acyl-CoA donorsTest multiple chain lengths and saturation levelsAGPAT4 may have species-specific substrate preferences
Detergent concentrationOptimize to maintain enzyme activity without disrupting substrate presentationCritical for membrane protein assays
pH optimizationTest range from 6.5-8.0pH affects both enzyme activity and substrate stability
Divalent cationsInclude Mg²⁺ and test Mn²⁺Essential cofactors for acyltransferase activity
Reaction timeEstablish linear range (typically 5-30 minutes)Ensures accurate initial velocity measurements
Product detectionLC-MS or radioactive assaysMost sensitive and specific detection methods

Common technical challenges:

  • Background acyltransferase activity in expression systems requires careful negative controls

  • Substrate solubility issues may necessitate optimization of delivery methods (liposomes, mixed micelles)

  • Product extraction efficiency can significantly impact quantitative results

  • Protein stability during the assay period must be verified

For Pongo abelii AGPAT4 specifically, researchers should consider comparative assays with human AGPAT4 under identical conditions to identify any species-specific kinetic parameters or substrate preferences.

How can researchers study AGPAT4 function in the context of neurodevelopmental disorders?

The high expression of AGPAT4 in neural tissues and its dynamic regulation during development suggest potential roles in neurodevelopmental processes . This presents opportunities for studying its function in relation to neurodevelopmental disorders:

  • Temporal expression patterns indicate AGPAT4 is significantly upregulated during mid-embryonic development (E14.5) when critical neural differentiation and migration occur

  • AGPAT4 is present in both neurons and glial cells, suggesting roles in multiple neural cell types

  • As a phospholipid biosynthesis enzyme, AGPAT4 may influence membrane composition affecting neurite outgrowth, synaptogenesis, and myelination

Recommended research approaches:

ApproachApplicationPotential Insights
iPSC-derived neural modelsStudy species-specific neural developmentDifferences in phospholipid composition during neurogenesis
CRISPR-engineered mutationsIntroduce disorder-associated variantsFunctional consequences on neural development
Organoid culturesExamine 3D developmental contextsEffects on cortical organization and cell migration
Comparative developmental expressionMap expression across speciesEvolutionary differences in neurodevelopmental timing
Lipidomics of neurodevelopmental stagesProfile phospholipid changesCritical periods of membrane remodeling

For studies using Pongo abelii AGPAT4, researchers could develop comparative models between human and orangutan neural development, potentially revealing how species-specific differences in phospholipid metabolism contribute to unique aspects of primate brain development and function.

What are the current limitations in AGPAT4 research and what methodological advances could address these challenges?

Despite increasing interest in AGPAT4 biology, several significant research challenges remain:

Current LimitationDescriptionPotential Methodological Solution
Purification difficultiesAs an integral membrane protein, AGPAT4 is challenging to purify while maintaining activityNovel detergents like 6-cyclohexyl-1-hexyl-β-d-maltoside or nanodiscs for membrane protein stabilization
Limited structural dataNo crystal structure available for any AGPAT4 orthologCryo-EM approaches for membrane protein structure determination
Substrate specificity uncertaintyIncomplete characterization of preferred acyl-CoA donorsHigh-throughput substrate screening with lipidomics detection
In vivo function gapsLimited understanding of physiological rolesTissue-specific and inducible knockout models
Interactions with other lipid metabolism enzymesUnknown regulatory networksProximity labeling approaches (BioID, APEX) to map protein interactions
Species-specific differencesIncomplete data on primate-specific functionsComparative studies across multiple primate species

For Pongo abelii AGPAT4 specifically, additional challenges include limited sample availability and ethical considerations for primate research. Researchers can address these limitations through:

  • Development of cell-based models using genetic engineering of accessible cell lines

  • Computational approaches to predict species-specific functions based on sequence variations

  • Non-invasive sampling methods when appropriate for endangered species

  • Advanced recombinant expression systems that better replicate post-translational modifications

How does AGPAT4 interact with the broader lipid metabolic network in Pongo abelii compared to humans?

AGPAT4 functions within a complex network of lipid metabolic enzymes. Understanding its position within this network in Pongo abelii compared to humans provides insights into potential species-specific metabolic adaptations:

Metabolic PathwayAGPAT4 InvolvementSpecies Comparison Considerations
Glycerophospholipid metabolismDirect role converting LPA to PACompare substrate preferences and product profiles
Glycerolipid metabolismIndirect influence through PA productionAssess downstream metabolite differences
General metabolic pathwaysIntegration with broader cellular metabolismExamine metabolic flux differences between species

Key interaction partners to investigate:

  • Other AGPAT family members (AGPAT1-5) - potential compensatory or cooperative mechanisms

  • Phospholipases - may regulate substrate availability

  • PA phosphatases - influence product utilization

  • Membrane transport proteins - affect substrate accessibility

Methodological approaches for network studies:

  • Metabolic flux analysis using stable isotope labeling

  • Protein-protein interaction studies (co-immunoprecipitation, proximity labeling)

  • Competitive enzyme assays to determine relative activities

  • Systems biology modeling of lipid metabolic networks

For comparative Pongo abelii studies, researchers should consider how evolutionary adaptations in phospholipid metabolism might relate to species-specific traits such as brain development, cognitive function, and metabolic adaptations to different ecological niches.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.