Recombinant Pongo abelii 3-hydroxyacyl-CoA dehydratase 2 (PTPLB)

Shipped with Ice Packs
In Stock

Description

Protein Identity

ParameterDescription
Gene NameHACD2 (Homolog: PTPLB)
UniProt IDQ5RBK3
SpeciesPongo abelii (Sumatran orangutan)
Expression HostE. coli
TagN-terminal His-tag
Protein LengthFull-length mature protein (2–255 amino acids)
SequenceAAAAAATAAAKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMTAGWLVIAVGLVRAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWA VTHSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGV SGELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPIFPQLYFHMIHQR RKILSHTEEHKKFE

Primary Function

PTPLB catalyzes the dehydration step in fatty acid (FA) elongation, converting 3-hydroxyacyl-CoA intermediates into trans-2-enoyl-CoA. This reaction is essential for elongating long-chain FAs (LCFAs) into very-long-chain FAs (VLCFAs), which are critical for membrane lipid synthesis and cellular function .

Localization and Pathways

  • Subcellular Location: Endoplasmic reticulum (ER) membrane .

  • Pathways:

    • FA Elongation: Collaborates with 3-ketoacyl-CoA reductases (e.g., HSD17B12) and trans-2-enoyl-CoA reductases (e.g., TECR) .

    • Redundancy with HACD1: Partial functional overlap with HACD1, particularly in saturated and monounsaturated FA pathways .

Recombinant Protein Characteristics

ParameterDetails
Purity>90% (SDS-PAGE)
Storage BufferTris/PBS-based buffer, 6% trehalose, pH 8.0
Storage Conditions-20°C/-80°C; avoid repeated freeze-thaw cycles
ReconstitutionDeionized water (0.1–1.0 mg/mL); add 5–50% glycerol for stability

Key Experimental Observations

Study FocusFindings
Substrate SpecificityBroad activity toward saturated, monounsaturated, and polyunsaturated 3-OH acyl-CoAs (C16–C22) .
Redundancy with HACD1HACD2 KO in HAP1 cells reduced elongation of C18–C22 FAs, while HACD1 HACD2 DKO caused near-complete loss of activity .
Tissue-Specific RolesHACD1 is muscle-specific, but HACD2 compensates in other tissues .
Enzyme ActivityHACD2 exhibits higher catalytic efficiency than HACD1 in FA elongation assays .

Functional Redundancy and Tissue Distribution

  • HACD1 vs. HACD2:

    • HACD1 is enriched in skeletal muscle and linked to myopathies, while HACD2 is more widely expressed .

    • Both enzymes support saturated/monounsaturated FA elongation, but HACD2 dominates in polyunsaturated FA pathways .

Experimental Uses

  1. Lipid Metabolism Studies:

    • Investigating VLCFA synthesis and membrane lipid diversity.

    • Exploring redundancy in FA elongation pathways .

  2. Therapeutic Targets:

    • Potential relevance to disorders involving lipid imbalances (e.g., sphingolipid disorders).

Comparative Analysis with Other HACDs

HACD IsoformSubstrate PreferenceTissue Expression
HACD1Saturated, monounsaturated FAsSkeletal muscle
HACD2Broad (saturated, monounsaturated, polyunsaturated)Ubiquitous
HACD3Weak activity in saturated/monounsaturatedLimited
HACD4No detectable activityNot defined

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference when placing the order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging this vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer ingredients, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
HACD2; PTPLB; Very-long-chain; 3R-3-hydroxyacyl-CoA dehydratase 2; 3-hydroxyacyl-CoA dehydratase 2; HACD2; Protein-tyrosine phosphatase-like member B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-255
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
HACD2
Target Protein Sequence
AAAAAATAAAKGNGGGGGRAGAGDASGTRKKKGPGPLATAYLVIYNVVMTAGWLVIAVGL VRAYLAKGSYHSLYYSIEKPLKFFQTGALLEILHCAIGIVPSSVVLTSFQVMSRVFLIWA VTHSVKEVQSEDSVLLFVIAWTITEIIRYSFYTFSLLNHLPYLIKWARYTLFIVLYPMGV SGELLTIYAALPFVRQAGLYSISLPNKYNFSFDYYAFLILIMISYIPIFPQLYFHMIHQR RKILSHTEEHKKFE
Uniprot No.

Target Background

Function
This enzyme catalyzes the dehydration step in the four-step cycle (condensation, reduction, dehydration, and reduction) of very long-chain fatty acid (VLCFA) elongation. This process, which occurs in the endoplasmic reticulum, involves the addition of two carbons to the lipid chain with each cycle. Specifically, this enzyme catalyzes the conversion of the 3-hydroxyacyl-CoA intermediate to trans-2,3-enoyl-CoA during each elongation cycle. Consequently, it participates in the production of various VLCFAs that are involved in multiple biological processes as precursors of membrane lipids and lipid mediators.
Database Links
Protein Families
Very long-chain fatty acids dehydratase HACD family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is 3-hydroxyacyl-CoA dehydratase 2 (PTPLB) and what is its primary function?

3-hydroxyacyl-CoA dehydratase 2 (PTPLB, also known as HACD2) is an essential enzyme in the fatty acid elongation pathway. It catalyzes the dehydration of 3-hydroxyacyl-CoA to trans-2-enoyl-CoA, which is the third step in the elongation cycle of fatty acids. This enzyme is critical for the synthesis of very long-chain fatty acids (VLCFAs) that are longer than 16 carbon atoms. The elongation process involves four sequential reactions: condensation, reduction, dehydration, and reduction again, with HACD2 catalyzing the dehydration step .

In the fatty acid elongation cycle, 3-ketoacyl-CoA reductases (KAR/HSD17B12 in mammals) first reduce 3-ketoacyl-CoAs to (R)-3-hydroxy (3-OH) forms. Subsequently, these 3-OH acyl-CoAs are dehydrated by 3-OH acyl-CoA dehydratases such as HACD2/PTPLB. The resulting trans-2-enoyl-CoAs are then reduced to acyl-CoAs, which have two more carbons than the original acyl-CoAs .

How does HACD2/PTPLB activity compare with other members of the HACD family?

HACD2 exhibits broad substrate specificity and is active toward saturated, monounsaturated, and polyunsaturated 3-OH acyl-CoAs of long- to very long-chain fatty acids. Comparative studies have shown that HACD2 generally exhibits greater activity than HACD1 across these substrates. In contrast, HACD3 shows only weak activity in saturated and monounsaturated fatty acid elongation pathways, while no activity has been detected for HACD4 .

The following table summarizes the comparative activities of HACD family members:

HACD Family MemberActivity LevelSubstrate Specificity
HACD2/PTPLBHighBroad (saturated, monounsaturated, and polyunsaturated FAs)
HACD1/PTPLAModerateBroad (saturated, monounsaturated, and polyunsaturated FAs)
HACD3/PTPLAD1WeakLimited (saturated and monounsaturated FAs)
HACD4/PTPLAD2Not detectedNot detected

What are the optimal storage and handling conditions for recombinant HACD2/PTPLB?

For optimal preservation of recombinant HACD2/PTPLB activity, the protein should be stored at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles, which can compromise protein integrity and activity. For short-term storage, working aliquots can be kept at 4°C for up to one week .

The lyophilized protein should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL. It is recommended to add glycerol to a final concentration of 5-50% (with 50% being the default concentration) and aliquot for long-term storage at -20°C/-80°C. Before opening, the vial should be briefly centrifuged to bring the contents to the bottom .

The storage buffer typically consists of a Tris/PBS-based buffer with 6% Trehalose at pH 8.0, which helps maintain protein stability .

How can researchers design experiments to study HACD2/PTPLB substrate specificity?

Designing experiments to study HACD2/PTPLB substrate specificity requires a multi-faceted approach combining in vitro biochemical assays with cellular models. One effective approach utilizes an in vitro fatty acid elongation assay where [14C]malonyl-CoA and various acyl-CoA species serve as substrates for the fatty acid elongation cycle .

To implement this methodology:

  • Express recombinant HACD2/PTPLB in a suitable expression system (typically E. coli for in vitro studies or yeast systems for functional complementation studies).

  • Prepare membrane fractions from the expressing cells.

  • Incubate the membrane fractions with [14C]malonyl-CoA and different acyl-CoA substrates (e.g., stearoyl-CoA (C18:0-CoA), palmitoyl-CoA (C16:0-CoA), or unsaturated acyl-CoAs).

  • After the reaction, convert the products to fatty acid methyl esters (FAMEs).

  • Separate the FAMEs by reverse-phase thin-layer chromatography (TLC).

  • Detect the products using autoradiography.

  • Quantify the results to determine substrate preferences .

For more detailed analysis, liquid chromatography-tandem mass spectrometry (LC-MS/MS) can be employed using stable isotope 13C-labeled malonyl-CoA, which allows precise quantification of the products and intermediates of the fatty acid elongation cycle .

What approaches can be used to investigate the functional redundancy between HACD1 and HACD2?

Investigating the functional redundancy between HACD1 and HACD2 requires complementary approaches at both molecular and cellular levels. Research has shown that HACD1 and HACD2 exhibit redundant activities in a wide range of fatty acid elongation pathways, although HACD2 generally displays greater activity .

To investigate this redundancy, researchers can employ:

  • Genetic knockout approaches: Generate single knockout (KO) cell lines for each HACD (HACD1 KO, HACD2 KO) and double knockout (DKO) cell lines (HACD1 HACD2 DKO) using CRISPR-Cas9 or other gene editing technologies. HAP1 cells have been successfully used for this purpose .

  • Metabolic labeling experiments: Incubate the KO and DKO cells with labeled fatty acid precursors (e.g., d31-C16:0-COOH) for a defined period (e.g., 6 hours). Extract lipids, hydrolyze to fatty acids by alkaline treatment, and quantify labeled fatty acids by LC-MS/MS analysis. This approach reveals the contribution of each HACD to the elongation of specific fatty acid species .

  • Functional complementation studies: In systems lacking endogenous 3-OH acyl-CoA dehydratase activity (e.g., yeast phs1Δ htd2Δ strains), express HACD1 or HACD2 and measure the restoration of fatty acid elongation activity .

  • Biochemical assays: Compare the activities of purified HACD1 and HACD2 toward various 3-OH acyl-CoA substrates in vitro.

Research using these approaches has demonstrated that HACD2 knockout leads to reduction in ≥C18 saturated and monounsaturated fatty acids, with concomitant increases in C16 fatty acids. The HACD1 HACD2 double knockout causes a greater decrease in C18:0 to C22:0 fatty acids than the HACD2 single knockout, highlighting their overlapping but distinct roles .

How do the kinetic properties of HACD2/PTPLB compare across different species?

Studies comparing the kinetic properties of HACD2/PTPLB across different species provide valuable insights into evolutionary conservation and functional specialization. While the search results don't provide direct comparative kinetic data across species, we can outline a methodological approach to address this question.

To determine and compare the kinetic properties of HACD2/PTPLB from different species (e.g., human, Pongo abelii, mouse, etc.), researchers should:

  • Express and purify recombinant HACD2/PTPLB proteins from different species using identical expression systems and purification protocols to ensure comparability.

  • Conduct enzyme kinetic assays using various concentrations of 3-OH acyl-CoA substrates under standardized conditions (temperature, pH, buffer composition).

  • Determine key kinetic parameters including:

    • Km (Michaelis constant) - indicating substrate affinity

    • kcat (turnover number) - indicating catalytic efficiency

    • kcat/Km ratio - indicating enzyme specificity

  • Compare these parameters across species to identify evolutionary conservation or divergence patterns.

  • Correlate kinetic differences with structural variations through sequence alignment and homology modeling approaches.

This comparative analysis can reveal whether functional differences exist between orthologous HACD2/PTPLB enzymes, potentially reflecting adaptation to species-specific lipid metabolism requirements.

What are the mechanisms of regulation for HACD2/PTPLB activity in vivo?

The regulation of HACD2/PTPLB activity in vivo involves multiple mechanisms that ensure proper control of fatty acid elongation. While the search results don't provide direct information about regulatory mechanisms, based on current understanding of similar enzymes, several potential regulatory mechanisms can be investigated:

  • Transcriptional regulation: Analyze the promoter regions of HACD2/PTPLB to identify binding sites for transcription factors involved in lipid metabolism (e.g., SREBP, PPARs, LXRs). Perform chromatin immunoprecipitation (ChIP) assays to confirm transcription factor binding.

  • Post-translational modifications: Investigate whether HACD2/PTPLB undergoes phosphorylation, acetylation, or other post-translational modifications that might modulate its activity. Use mass spectrometry-based proteomics approaches to identify modification sites.

  • Protein-protein interactions: Identify proteins that interact with HACD2/PTPLB using techniques such as co-immunoprecipitation, yeast two-hybrid screening, or proximity labeling approaches (BioID, APEX). These interactions may regulate HACD2/PTPLB activity or localization.

  • Subcellular localization: Examine whether the distribution of HACD2/PTPLB within cellular compartments changes in response to metabolic cues using fluorescence microscopy with tagged proteins or subcellular fractionation followed by immunoblotting.

  • Substrate availability: Investigate how changes in substrate availability affect HACD2/PTPLB activity, particularly in response to dietary interventions or metabolic perturbations.

Understanding these regulatory mechanisms is crucial for elucidating how cells maintain appropriate levels of very long-chain fatty acids under varying physiological conditions.

What is the optimal protocol for expressing and purifying recombinant HACD2/PTPLB?

The optimal protocol for expressing and purifying recombinant HACD2/PTPLB involves several critical steps:

Expression System Selection:
E. coli is commonly used for expressing recombinant Pongo abelii 3-hydroxyacyl-CoA dehydratase 2 (PTPLB) . For functional studies, yeast expression systems can also be employed, particularly when complementation of yeast mutants (e.g., phs1Δ) is desired .

Expression Protocol:

  • Clone the HACD2/PTPLB coding sequence (amino acids 2-255 for Pongo abelii) into an appropriate expression vector with an N-terminal His tag.

  • Transform the construct into an E. coli expression strain (e.g., BL21(DE3)).

  • Grow transformed bacteria in suitable media (e.g., LB or TB) with appropriate antibiotics.

  • Induce protein expression with IPTG (typically 0.5-1 mM) when cultures reach mid-log phase (OD600 of 0.6-0.8).

  • Continue expression at a reduced temperature (16-25°C) for 16-18 hours to enhance proper folding.

Purification Protocol:

  • Harvest cells by centrifugation and resuspend in lysis buffer containing protease inhibitors.

  • Lyse cells using sonication, French press, or enzymatic methods.

  • Clarify the lysate by centrifugation at high speed (≥20,000 × g).

  • Perform immobilized metal affinity chromatography (IMAC) using Ni-NTA or similar resin to capture the His-tagged protein.

  • Wash extensively to remove non-specifically bound proteins.

  • Elute the protein with an imidazole gradient or step elution.

  • Perform size exclusion chromatography to enhance purity and remove aggregates.

  • Concentrate the purified protein and exchange into storage buffer (Tris/PBS-based buffer with 6% Trehalose, pH 8.0).

  • Add glycerol (up to 50% final concentration) and store in aliquots at -20°C/-80°C .

Quality Control:

  • Verify protein purity by SDS-PAGE (should be >90%).

  • Confirm identity by mass spectrometry or western blotting.

  • Assess activity using in vitro fatty acid elongation assays before long-term storage.

How can researchers establish a reliable in vitro fatty acid elongation assay using HACD2/PTPLB?

Establishing a reliable in vitro fatty acid elongation assay to study HACD2/PTPLB activity requires careful consideration of various factors. The following protocol is based on established methodologies:

Materials Required:

  • Purified recombinant HACD2/PTPLB or membrane fractions containing the expressed protein

  • [14C]malonyl-CoA or 13C-labeled malonyl-CoA (for LC-MS/MS analysis)

  • Various acyl-CoA substrates (e.g., palmitoyl-CoA, stearoyl-CoA)

  • Cofactors (NADPH)

  • Appropriate buffer system

Assay Protocol:

  • Preparation of membrane fractions (if using cellular expression systems):

    • Homogenize cells in buffer containing 0.25 M sucrose, 10 mM HEPES-NaOH (pH 7.4), and protease inhibitors.

    • Centrifuge at low speed to remove nuclei and cell debris.

    • Ultracentrifuge the supernatant to collect membrane fractions.

    • Resuspend the membrane pellet in assay buffer.

  • Reaction setup:

    • Combine membrane fractions or purified protein with acyl-CoA substrate, [14C]malonyl-CoA (or 13C-malonyl-CoA), NADPH, and buffer.

    • Incubate the reaction mixture at 37°C for 30-60 minutes.

  • Product analysis:

    • For radioactive assays, terminate the reaction with chloroform/methanol (2:1, v/v).

    • Extract lipids and convert to fatty acid methyl esters (FAMEs) using methanolic HCl or NaOH followed by methylation.

    • Separate FAMEs by reverse-phase TLC and visualize by autoradiography.

    • Alternatively, analyze products by LC-MS/MS for more precise quantification .

  • Data analysis:

    • Quantify the radioactivity or MS signal intensity of each product.

    • Calculate the conversion rates and enzyme activity.

Critical Considerations:

  • Maintain consistent protein concentration across comparative experiments.

  • Include appropriate controls (e.g., no enzyme, heat-inactivated enzyme).

  • Optimize reaction conditions (time, temperature, pH) for the specific protein being studied.

  • Ensure substrate concentrations are within a linear range for accurate kinetic determinations.

This assay allows researchers to evaluate the dehydratase activity of HACD2/PTPLB in the context of the complete fatty acid elongation cycle .

What techniques are available for studying HACD2/PTPLB function in cellular models?

Several complementary techniques can be employed to study HACD2/PTPLB function in cellular models:

1. Genetic Manipulation Approaches:

  • CRISPR-Cas9 gene editing: Generate knockout (KO) cell lines by disrupting the HACD2/PTPLB gene. This has been successfully implemented in HAP1 cells to create HACD1 KO, HACD2 KO, and HACD1 HACD2 double KO (DKO) cell lines .

  • RNA interference (RNAi): Use siRNA or shRNA to transiently or stably knockdown HACD2/PTPLB expression.

  • Overexpression studies: Express wild-type or mutant forms of HACD2/PTPLB to study gain-of-function effects or structure-function relationships.

2. Metabolic Labeling and Lipidomic Analysis:

  • Stable isotope labeling: Incubate cells with isotopically labeled fatty acid precursors (e.g., d31-C16:0-COOH) to track their metabolic fate.

  • Lipidomic profiling: Extract cellular lipids and analyze them using LC-MS/MS to determine changes in fatty acid composition and very long-chain fatty acid levels.

  • Pulse-chase experiments: Use pulse-chase labeling to study the kinetics of fatty acid elongation .

3. Functional Rescue Experiments:

  • Complementation studies: Reintroduce wild-type or mutant HACD2/PTPLB into knockout cells to assess functional rescue.

  • Cross-species complementation: Express HACD2/PTPLB from different species in knockout cells to study evolutionary conservation of function.

4. Protein Localization and Interaction Studies:

  • Immunofluorescence microscopy: Visualize the subcellular localization of HACD2/PTPLB using specific antibodies or fluorescent protein tags.

  • Co-immunoprecipitation: Identify protein-protein interactions within the fatty acid elongation complex.

  • Proximity labeling: Use BioID or APEX approaches to identify proteins in the vicinity of HACD2/PTPLB in living cells.

5. Physiological and Phenotypic Analysis:

  • Membrane fluidity assays: Assess changes in membrane properties resulting from altered very long-chain fatty acid composition.

  • Cell growth and viability assays: Evaluate the impact of HACD2/PTPLB manipulation on cellular physiology.

  • Stress response experiments: Examine how HACD2/PTPLB-deficient cells respond to various stressors (e.g., lipotoxicity, temperature changes).

Research has demonstrated that HACD2 knockout in HAP1 cells results in reduced levels of ≥C18 saturated and monounsaturated fatty acids, with concomitant increases in C16 fatty acids. The HACD1 HACD2 double knockout causes even greater alterations in fatty acid profiles, highlighting the partially redundant functions of these enzymes .

How can researchers troubleshoot common issues with recombinant HACD2/PTPLB experiments?

When working with recombinant HACD2/PTPLB, researchers may encounter various technical challenges. Here are strategies to troubleshoot common issues:

1. Low Protein Expression Issues:

  • Problem: Poor expression of recombinant HACD2/PTPLB in E. coli.

  • Troubleshooting approaches:

    • Optimize codon usage for the expression host.

    • Test different E. coli strains (BL21(DE3), Rosetta, Arctic Express).

    • Reduce expression temperature (16-18°C) to enhance proper folding.

    • Use richer media (TB instead of LB) or auto-induction media.

    • Optimize induction conditions (IPTG concentration, induction time).

    • Consider using a fusion partner (e.g., MBP, GST) to enhance solubility.

2. Protein Solubility and Stability Problems:

  • Problem: HACD2/PTPLB forms inclusion bodies or aggregates.

  • Troubleshooting approaches:

    • Express the protein with solubility-enhancing tags.

    • Include low concentrations of mild detergents in lysis and purification buffers.

    • Add stabilizing agents (glycerol, trehalose) to storage buffer.

    • Avoid repeated freeze-thaw cycles by storing in small aliquots at -80°C .

    • Test different buffer systems and pH conditions for optimal stability.

3. Activity Assay Challenges:

  • Problem: Low or inconsistent activity in in vitro fatty acid elongation assays.

  • Troubleshooting approaches:

    • Verify protein integrity by SDS-PAGE before each experiment.

    • Ensure all cofactors (NADPH) are fresh and at appropriate concentrations.

    • Optimize reaction conditions (temperature, pH, ionic strength).

    • Check for the presence of inhibitory contaminants in reagents.

    • Include positive controls (e.g., yeast Phs1) in parallel reactions .

    • Consider using freshly prepared membrane fractions instead of purified protein for more physiological conditions.

4. Mass Spectrometry Analysis Issues:

  • Problem: Difficulty detecting or quantifying fatty acid elongation products.

  • Troubleshooting approaches:

    • Optimize extraction methods for complete recovery of fatty acids and intermediates.

    • Use internal standards for accurate quantification.

    • Ensure proper derivatization of fatty acids for GC-MS or LC-MS analysis.

    • Optimize MS parameters (ionization conditions, collision energies) for the specific analytes.

    • Consider alternative detection methods (e.g., radioactive assays) if MS sensitivity is insufficient.

5. Cellular Model Complications:

  • Problem: Inconsistent phenotypes in HACD2/PTPLB knockout or knockdown cells.

  • Troubleshooting approaches:

    • Verify knockout/knockdown efficiency at both mRNA and protein levels.

    • Consider potential compensation by other HACD family members (HACD1, HACD3) .

    • Extend the analysis timeframe to allow for metabolic adaptation.

    • Use multiple cell lines to confirm phenotypes across different genetic backgrounds.

    • Create and validate multiple independent knockout clones to rule out off-target effects.

Implementing these troubleshooting strategies can help researchers overcome technical challenges and generate reliable data when working with recombinant HACD2/PTPLB.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.