Recombinant Pongo abelii Acyl-CoA-binding domain-containing protein 5 (ACBD5)

Shipped with Ice Packs
In Stock

Description

General Information

Recombinant Pongo abelii Acyl-CoA-Binding Domain-Containing Protein 5 (ACBD5) is a protein expressed in E. coli and fused to an N-terminal His tag . ACBD5, also known as Acyl-CoA-binding domain-containing protein 5, is a protein that in humans is encoded by the ACBD5 gene . ACBD5 is a peroxisomal membrane protein that interacts with vesicle-associated membrane protein-associated protein B (VAPB), a resident ER protein .

Table 1: General Information of Recombinant Pongo abelii ACBD5

FeatureDescription
SpeciesPongo abelii (Sumatran orangutan)
SourceE. coli
TagHis
Protein LengthFull Length (1-525 amino acids)
FormLyophilized powder
SynonymsACBD5; Acyl-CoA-binding domain-containing protein 5
UniProt IDQ5R7V3
PurityGreater than 90% as determined by SDS-PAGE
StorageStore at -20°C/-80°C upon receipt, aliquoting is necessary for multiple use. Avoid repeated freeze-thaw cycles.
Storage BufferTris/PBS-based buffer, 6% Trehalose, pH 8.0

Amino Acid Sequence

The amino acid sequence for Recombinant Full Length Pongo abelii Acyl-CoA-Binding Domain-Containing Protein 5(ACBD5) Protein, His-Tagged is :
MLFLSFHAGSWESWCCCCLIPADRPWDRGQHWQLEMADTRSVHETRFEAAVKVIQSLPKN
GSFQPTNEMMLKFYSFYKQATEGPCKLSRPGFWDPIGRYKWDAWSSLGDMTKEEAMSAYV
EEMKKIIETMPMTEKVEELLRVIGPFYEIVEDKKSGRSSDITSDLDNVLTSTPNAKTVNG
KAESSDSGAESEEEEAQEEVKGAEQSDNDKKMMKKSADHKNLEVIVTNGYDKDGFVQDIQ
NDIHASSSLNGRSTEEVKPIEENLGQTGKSAVCIHQDINDDHVEDVAGIQHLTSDSDSEV
YCDSMEQFGQEESLDSFTSNNGPFQYYLGGHSSQPVENSGFCEDVQVPPGNGNIGNMQVV
AVEGKGEVKHGGEDGRNNSGAPHREKRGGESDEFSNVRRGRGHRMQYLSEGTKGRQVGSG
GDGERWGSDRGSRGSLNEQIALVLMRLQEDMQNVLQRLQKLETLTALQAKSSTTTLQTTP
QPTSQRPSWWPFEMSPGVLTFAIIWPFIARWLVYLYYQRRRRKLN

Function and Role

ACBD5 is involved in several cellular processes:

  1. Peroxisome-Endoplasmic Reticulum (PO-ER) Tethering: ACBD5 mediates the association between peroxisomes (POs) and the endoplasmic reticulum (ER) . The interaction between ACBD5 and VAPB regulates these PO-ER associations . Loss of this association perturbs PO membrane expansion and increases PO motility .

  2. Lipid Metabolism: ACBD5 can interact with activated fatty acids and very long chain-fatty acids (VLCFA), suggesting a role in lipid metabolism . It may capture fatty acids for peroxisomal β-oxidation . Peroxisome tethering to the ER creates a lipid hub, which allows tight coordination of fatty acid synthesis and elongation at the ER and breakdown by peroxisomal β-oxidation .

  3. Phagophore Formation: ACBD5 and its fungal orthologue, ATG37, have a role in phagophore formation during pexophagy (selective autophagy of peroxisomes) .

Clinical Significance

Mutations in ACBD5 are associated with severe neurological disorders :

  • Retinal Dystrophy and Leukodystrophy (RDLKD): ACBD5-related RDLKD is a neurodegenerative disease with consistent neuroradiological features, including hypomyelination with diffuse hyperintense T2 and FLAIR signal abnormality in white matter . Atrophic changes in the cerebellar hemispheres, brainstem, and thoracic spinal cord are also observed .

  • Papillary Thyroid Cancer: ACBD5-RET rearrangement is causatively involved in the development of papillary thyroid cancer .

Research Findings

  1. ACBD5-VAPB Interaction: ACBD5 directly interacts with VAPB via a FFAT-like motif in ACBD5 . Co-expression of ACBD5 and VAPB increases PO-ER associations, while knockdown of ACBD5 and VAPB reduces these interactions . Loss of ACBD5 increases PO movements, and loss of ACBD5 or VAPB perturbs PO membrane expansion .

  2. Impact on Peroxisome Morphology and Movement: Studies have shown that silencing ACBD5 in cells leads to increased peroxisomal movement . ACBD5 is crucial for maintaining proper peroxisomal membrane expansion and stability .

  3. ACBD5 in Rhodnius prolixus: In the insect Rhodnius prolixus, the ACBD5 gene (RpACBD-5) is highly expressed in the posterior midgut after feeding and in pre-vitellogenic and vitellogenic oocytes . Recombinant RpACBD-5 binds to acyl-CoA of different lengths, with nanomolar affinity to lauroyl-CoA, indicating it is a functional ACBP .

Recombinant Protein Properties

PropertyDescription
SourceE. coli
TagHis-tagged
Purity>80% as determined by SDS-PAGE
Endotoxin LevelLess than 1.0 EU per μg of protein, as determined by the LAL method
Storage ConditionsShort term: +4 ºC; Long term: -20 ºC to -80 ºC
BufferPBS buffer

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional charges apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The specific tag type is finalized during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
ACBD5; Acyl-CoA-binding domain-containing protein 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-525
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
ACBD5
Target Protein Sequence
MLFLSFHAGSWESWCCCCLIPADRPWDRGQHWQLEMADTRSVHETRFEAAVKVIQSLPKN GSFQPTNEMMLKFYSFYKQATEGPCKLSRPGFWDPIGRYKWDAWSSLGDMTKEEAMSAYV EEMKKIIETMPMTEKVEELLRVIGPFYEIVEDKKSGRSSDITSDLDNVLTSTPNAKTVNG KAESSDSGAESEEEEAQEEVKGAEQSDNDKKMMKKSADHKNLEVIVTNGYDKDGFVQDIQ NDIHASSSLNGRSTEEVKPIEENLGQTGKSAVCIHQDINDDHVEDVAGIQHLTSDSDSEV YCDSMEQFGQEESLDSFTSNNGPFQYYLGGHSSQPVENSGFCEDVQVPPGNGNIGNMQVV AVEGKGEVKHGGEDGRNNSGAPHREKRGGESDEFSNVRRGRGHRMQYLSEGTKGRQVGSG GDGERWGSDRGSRGSLNEQIALVLMRLQEDMQNVLQRLQKLETLTALQAKSSTTTLQTTP QPTSQRPSWWPFEMSPGVLTFAIIWPFIARWLVYLYYQRRRRKLN
Uniprot No.

Target Background

Function

Acyl-CoA binding protein functioning as the peroxisome receptor for pexophagy; dispensable for aggrephagy and nonselective autophagy. It binds medium- and long-chain acyl-CoA esters.

Database Links
Protein Families
ATG37 family
Subcellular Location
Peroxisome membrane; Single-pass membrane protein.

Q&A

What is ACBD5 and what is its fundamental role in cellular function?

ACBD5 (Acyl-CoA-binding domain-containing protein 5) is a tail-anchored membrane protein that localizes to peroxisomes and plays a critical role in tethering peroxisomes to the endoplasmic reticulum (ER). This tethering function is essential for proper cellular metabolism, particularly for lipid processing. ACBD5 contains an N-terminal acyl-CoA binding (ACB) domain, a central region with an FFAT-like motif (two phenylalanines in an acidic tract), and a C-terminal transmembrane domain that anchors it to the peroxisomal membrane .

The primary function of ACBD5 involves forming contact sites between peroxisomes and the ER through interaction with the ER-resident protein VAPB (vesicle-associated membrane protein-associated protein B). This interaction is mediated specifically through the FFAT-like motif of ACBD5 binding to the MSP (major sperm protein) domain of VAPB . These membrane contact sites are crucial for several cellular processes, including:

  • Facilitating lipid transfer between organelles

  • Supporting peroxisome biogenesis through membrane expansion

  • Contributing to metabolism of very long-chain fatty acids (VLCFAs)

  • Maintaining proper plasmalogen and cholesterol levels

Loss of ACBD5 results in reduced physical tethering between the ER and peroxisomes, increased peroxisomal movement, reduced peroxisomal membrane expansion, and metabolic alterations including increased levels of VLCFAs .

How should researchers handle and store recombinant ACBD5 protein?

Proper handling and storage of recombinant ACBD5 protein is critical for maintaining its structural integrity and biological activity. Based on established protocols, the following guidelines should be followed :

Storage ParameterRecommendation
Long-term storage-20°C or -80°C
Working aliquots4°C for up to one week
FormLyophilized powder
Storage bufferTris/PBS-based buffer with 6% Trehalose, pH 8.0
Freeze-thaw cyclesAvoid repeated cycles

For reconstitution of lyophilized ACBD5 protein:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended: 50%)

  • Aliquot for long-term storage at -20°C/-80°C

This approach minimizes protein degradation and maintains functionality for experimental use . Proper aliquoting is necessary to avoid repeated freeze-thaw cycles which can compromise protein integrity.

How does ACBD5 differ from its close homolog ACBD4?

CharacteristicACBD4ACBD5
Domain structureN-terminal ACB domain, FFAT motif, coiled-coil region, C-terminal tail anchorSame arrangement as ACBD4
VAPB interactionCan interact with VAPB via FFAT motifCan interact with VAPB via FFAT motif
Tethering capacity when overexpressedCan increase peroxisome-ER contactsCan increase peroxisome-ER contacts
Effect of knockoutNo significant change in peroxisome-ER contacts in HEK293 cellsSignificant decrease in peroxisome-ER contacts
Complementation abilityCan restore peroxisome-ER contacts when expressed in ACBD5 KO cellsCan restore peroxisome-ER contacts when expressed in ACBD5 KO cells
Physiological significanceLess significant role in organelle tethering under tested conditionsMajor tether for peroxisome-ER interaction

Both proteins can functionally tether peroxisomes to the ER when overexpressed, but experimental evidence indicates that ACBD5 plays a more significant physiological role in this process. ACBD4 knockout does not significantly affect peroxisome-ER contacts, while ACBD5 knockout substantially reduces these interactions .

What experimental approaches can be used to study ACBD5-VAPB interactions?

Several methodological approaches can be employed to investigate ACBD5-VAPB interactions at both molecular and cellular levels:

  • Immunoprecipitation (IP) assays:

    • Co-IP experiments with tagged versions of ACBD5 (e.g., FLAG-ACBD5 or Myc-ACBD5) and VAPB (e.g., Myc-VAPB) expressed in mammalian cells like COS-7

    • Pull-down of tagged ACBD5 followed by immunoblotting for VAPB or vice versa

    • This approach can confirm protein-protein interactions in cellular contexts

  • In vitro binding assays with recombinant proteins:

    • Expression and purification of recombinant ACBD5 and VAPB from E. coli

    • Direct binding assays using purified proteins to confirm direct interaction

    • This eliminates potential cellular cofactors that might mediate indirect interactions

  • Mutational analysis:

    • Generation of FFAT motif mutants by site-directed mutagenesis

    • Generation of ACB domain mutants to disrupt lipid binding

    • Testing these mutants in binding assays to determine critical residues for interaction

  • Quantitative microscopy for peroxisome-ER contact assessment:

    • Fluorescence microscopy with organelle-specific markers

    • Measurement of "Mean attachment" (proportion of peroxisomes in close proximity to ER)

    • Measurement of "Mean ER contact" (proportion of peroxisomal surface closely opposed to ER)

    • These approaches can quantify the functional consequence of ACBD5-VAPB interactions

  • Genetic approaches:

    • CRISPR/Cas9-mediated knockout of ACBD5

    • siRNA-mediated silencing of ACBD5 or VAPB

    • Stable cell lines expressing wild-type or mutant forms of ACBD5 using FlpIn system

    • These systems allow assessment of loss-of-function and complementation effects

These methodological approaches provide complementary information about the molecular determinants and cellular consequences of ACBD5-VAPB interactions.

How does the functional significance of the ACB domain compare to the FFAT motif in ACBD5?

The ACB domain and FFAT motif of ACBD5 serve distinct functions that can be dissected through targeted mutations and functional assays. Research comparing these domains has revealed crucial insights into their differential roles in ACBD5 function :

DomainMolecular FunctionEffect of Mutation on VAPB BindingEffect of Mutation on Peroxisome-ER TetheringEffect of Mutation on VLCFA Metabolism
ACB domainAcyl-CoA bindingNo effectNo significant effectCannot complement ACBD5 KO phenotype; C26:0 levels remain elevated
FFAT motifVAPB bindingDisrupts bindingPrevents increase in peroxisome-ER contactsCan complement ACBD5 KO phenotype; C26:0 levels return to near normal

These findings reveal a critical insight: while the FFAT motif is essential for ACBD5's tethering function through interaction with VAPB, this tethering is not strictly required for VLCFA metabolism. Instead, the ACB domain, which mediates lipid binding, is crucial for VLCFA processing .

In complementation experiments using stable expression in ACBD5 knockout cells:

  • Wild-type ACBD5 expression restored normal C26:0 and C26:0-lysoPC levels

  • ACBD5 with mutated ACB domain failed to complement the metabolic defect

  • Surprisingly, ACBD5 with mutated FFAT motif (defective in ER tethering) successfully complemented the defect in VLCFA metabolism

This indicates a functional separation between ACBD5's roles in organelle tethering and lipid metabolism, with the ACB domain being indispensable for proper VLCFA processing regardless of tethering capacity .

What methods can be employed to quantify peroxisome-ER contacts in cells with modified ACBD5 expression?

Quantification of peroxisome-ER contacts is essential for understanding the tethering function of ACBD5. Several methodological approaches can be used to precisely measure these contacts in cells with modified ACBD5 expression :

  • Fluorescence microscopy with quantitative analysis:

    • Labeling of peroxisomes with specific markers (e.g., fluorescent proteins targeted to peroxisomes)

    • Labeling of ER with specific markers (e.g., ER-targeted fluorescent proteins)

    • Acquisition of high-resolution images

    • Quantification of two key parameters:

      • "Mean attachment" - percentage of peroxisomes in close proximity to the ER

      • "Mean ER contact" - proportion of the peroxisomal surface closely opposed to the ER

  • Experimental manipulations for comparative analysis:

    • Overexpression studies: Co-expression of ACBD5 (wild-type or mutant forms) with VAPB

    • Loss-of-function studies: ACBD5 knockout or knockdown cells

    • Complementation studies: Re-expression of wild-type or mutant ACBD5 in knockout cells

    • Double manipulation: ACBD4 knockout combined with ACBD5 silencing to test for compensatory effects

  • Statistical analysis:

    • Calculation of mean values across multiple cells and experiments

    • Statistical testing to determine significance of differences between experimental conditions

    • Consideration of expression levels of exogenous proteins

Using these approaches, researchers have determined that co-expression of wild-type ACBD5 and VAPB increases peroxisome-ER contacts (Mean attachment: from ~66% to 86%, Mean ER contact: from ~19% to 35%), while expression of FFAT motif mutants fails to increase these contacts. Similar effects were observed with ACBD4, indicating functional similarity in tethering capacity when overexpressed .

What are the methodological approaches for studying the impact of ACBD5 deficiency on lipid metabolism?

ACBD5 deficiency impacts lipid metabolism, particularly the processing of very long-chain fatty acids (VLCFAs). Several methodological approaches can be employed to study these metabolic effects :

  • Lipid profiling of endogenous fatty acids:

    • Extraction of cellular lipids using standardized protocols

    • Analysis of C26:0 levels by methods such as gas chromatography-mass spectrometry (GC-MS)

    • Measurement of C26:0-lysoPC as a marker for VLCFA accumulation

    • Comparison between wild-type, ACBD5 knockout, and complemented cell lines

  • Isotope-labeled fatty acid loading tests:

    • Treatment of cells with deuterated C22:0 (D3:C22:0)

    • Tracking the conversion to D3:C26:0

    • Calculation of D3:C16:0/D3:C26:0 ratios as a measure of β-oxidation efficiency

    • This approach allows for dynamic assessment of fatty acid metabolism

  • Complementation studies:

    • Generation of stable cell lines expressing wild-type or mutant ACBD5 using systems like FlpIn

    • Introduction of specific mutations in:

      • ACB domain to disrupt lipid binding

      • FFAT motif to disrupt VAPB binding and ER tethering

    • Assessment of restoration of normal lipid metabolism

  • Protein expression verification:

    • Western blotting to confirm expression levels of wild-type and mutant ACBD5 proteins

    • This control ensures that phenotypic differences are not due to expression level variations

Using these approaches, researchers have discovered that ACBD5 knockout cells accumulate C26:0 and show altered D3:C16:0/D3:C26:0 ratios, indicating defective VLCFA metabolism. Importantly, while expression of wild-type ACBD5 or the FFAT mutant (defective in ER tethering) can restore normal metabolism, the ACB domain mutant cannot complement this defect . This reveals that the lipid-binding function of ACBD5, rather than its tethering function, is critical for VLCFA metabolism.

How can researchers design experiments to distinguish between the dual functions of ACBD5 in organelle tethering and lipid metabolism?

Designing experiments to dissect the dual functions of ACBD5 requires strategic approaches that can separate its roles in organelle tethering and lipid metabolism. The following experimental design framework provides a methodological approach :

  • Domain-specific mutant generation and characterization:

    • Create targeted mutations in distinct functional domains:

      • ACB domain mutants: Disrupt acyl-CoA binding while preserving VAPB interaction

      • FFAT motif mutants: Disrupt VAPB binding while preserving acyl-CoA binding

    • Confirm the molecular effects of these mutations through:

      • Binding assays with recombinant proteins

      • Immunoprecipitation in cellular systems

      • Verification of expression levels by Western blotting

  • Hierarchical analysis of cellular phenotypes:

    • Assess organelle tethering through microscopy-based quantification:

      • Measure peroxisome-ER contacts with each mutant

      • Quantify peroxisome mobility (affected by tethering)

    • Evaluate lipid metabolism independently:

      • Measure VLCFA levels (C26:0, C26:0-lysoPC)

      • Perform isotope-labeled fatty acid loading tests (D3:C22:0 → D3:C26:0)

      • Analyze plasmalogen and cholesterol levels

  • Complementation strategy in knockout systems:

    • Generate ACBD5 knockout cell lines (e.g., using CRISPR/Cas9)

    • Create stable lines re-expressing:

      • Wild-type ACBD5 (positive control)

      • ACB domain mutant ACBD5

      • FFAT motif mutant ACBD5

    • Evaluate restoration of both tethering and metabolic functions independently

  • Cross-functional analysis with related proteins:

    • Compare ACBD5 with the structurally similar ACBD4

    • Test if ACBD4 can complement ACBD5 deficiency for:

      • Organelle tethering

      • Lipid metabolism

This experimental approach has revealed that the tethering function (dependent on the FFAT motif) and the metabolic function (dependent on the ACB domain) of ACBD5 can be uncoupled. While tethering requires VAPB interaction via the FFAT motif, proper VLCFA metabolism depends on the ACB domain but not necessarily on efficient tethering . These findings highlight the multifunctional nature of ACBD5 and provide a methodological framework for investigating other proteins with multiple cellular roles.

What are the neurological implications of ACBD5 deficiency and how can researchers model these effects?

ACBD5 deficiency has significant neurological implications, as patients present with severe neurological problems . These neurological effects are linked to altered lipid metabolism, particularly the production of nerve lipids that depend on proper peroxisome-ER collaboration. Researchers can model and study these effects through several approaches:

  • Patient-derived cell models:

    • Fibroblasts or induced pluripotent stem cells (iPSCs) from ACBD5-deficient patients

    • Differentiation of iPSCs into neurons to study cell type-specific effects

    • Analysis of lipid profiles in patient-derived cells compared to controls

  • ACBD5 knockout/knockdown in neuronal models:

    • Generation of ACBD5 knockout in neuronal cell lines

    • CRISPR/Cas9-mediated knockout in primary neuronal cultures

    • RNAi-mediated knockdown in neuronal systems

    • Evaluation of morphological, functional, and biochemical changes

  • Analysis of nerve-specific lipids:

    • Measurement of plasmalogens, which are critical for nerve function

    • Assessment of very long-chain fatty acid metabolism in neuronal models

    • Evaluation of myelin components in cellular or animal models

  • Mechanistic dissection using the ACBD5-VAPB interaction:

    • Quantification of ACBD5-VAPB binding through immunoprecipitation or fluorescence-based assays

    • Analysis of phosphorylation status of the FFAT-like motif in neuronal contexts

    • Examination of how reduced ACBD5-VAPB binding affects peroxisome-ER "hugging" and subsequent lipid production

Understanding the neurological consequences of ACBD5 deficiency requires connecting the molecular functions of the protein to cellular phenotypes and ultimately to clinical manifestations. By systematically studying how ACBD5 deficiency affects neuronal lipid metabolism and function, researchers can gain insights into the pathophysiology of associated neurological disorders and potentially identify therapeutic approaches.

How can researchers design assays to study the phosphorylation-dependent regulation of ACBD5-VAPB interaction?

The interaction between ACBD5 and VAPB is regulated by phosphorylation of the FFAT-like motif in ACBD5 . Designing assays to study this phosphorylation-dependent regulation requires a multi-faceted approach:

  • Identification of phosphorylation sites:

    • Mass spectrometry analysis of purified ACBD5 to identify phosphorylated residues

    • Bioinformatic prediction of potential phosphorylation sites within and adjacent to the FFAT-like motif

    • Generation of phospho-specific antibodies for ACBD5

  • Phosphorylation state manipulation:

    • Treatment of cells with phosphatase inhibitors to increase phosphorylation

    • Treatment with kinase inhibitors to decrease phosphorylation

    • Generation of phosphomimetic mutants (e.g., serine/threonine to aspartate/glutamate)

    • Generation of phospho-deficient mutants (e.g., serine/threonine to alanine)

  • Binding assays with phosphorylation variants:

    • Co-immunoprecipitation of wild-type versus mutant ACBD5 with VAPB

    • In vitro binding assays with recombinant proteins in different phosphorylation states

    • Surface plasmon resonance or isothermal titration calorimetry to determine binding affinities

  • Cellular assays for functional consequences:

    • Quantification of peroxisome-ER contacts with phosphomimetic or phospho-deficient ACBD5

    • Live-cell imaging to assess dynamic regulation of contacts in response to stimuli that affect phosphorylation

    • Measurement of lipid metabolism in cells expressing different ACBD5 phosphorylation variants

These methodological approaches can help determine how phosphorylation regulates the ACBD5-VAPB interaction and subsequently affects peroxisome-ER contacts and cellular metabolism. Understanding this regulatory mechanism may provide insights into how cells dynamically control organelle interactions in response to metabolic or environmental changes.

What are the critical quality control parameters for recombinant ACBD5 production and validation?

Quality control of recombinant ACBD5 is essential for ensuring reliable experimental results. Several critical parameters should be monitored during production and validation :

Quality Control ParameterMethodAcceptance Criteria
PuritySDS-PAGEGreater than 90%
IdentityMass spectrometryMatch to theoretical mass
Intact proteinWestern blotSingle band at expected molecular weight
Functional activityACB domain: Lipid binding assay
FFAT motif: VAPB binding assay
Specific binding to expected targets
Aggregation stateSize exclusion chromatographyPredominantly monomeric form
Endotoxin levelsLAL assayBelow threshold for experimental system
Biological activityComplementation in ACBD5 KO cellsRestoration of normal phenotype

Additional technical considerations include:

  • Expression system selection (E. coli is commonly used)

  • Purification strategy (His-tag affinity purification is effective)

  • Buffer composition (Tris/PBS-based buffer with 6% Trehalose, pH 8.0)

  • Storage conditions (-20°C/-80°C with aliquoting to prevent freeze-thaw cycles)

  • Reconstitution protocol (deionized sterile water with 5-50% glycerol)

Validation of recombinant ACBD5 should also include functional assays to confirm that the protein retains its expected biological activities, such as binding to acyl-CoA through its ACB domain and interacting with VAPB through its FFAT motif.

What experimental controls are essential when studying ACBD5-mediated peroxisome-ER interactions?

When investigating ACBD5-mediated peroxisome-ER interactions, implementing appropriate experimental controls is critical for generating reliable and interpretable data :

  • Positive controls:

    • Wild-type ACBD5 expression in knockout cells (for complementation studies)

    • Co-expression of wild-type ACBD5 and VAPB (for tethering studies)

    • Known peroxisome-ER tethering proteins or systems

  • Negative controls:

    • Empty vector transfection

    • Expression of irrelevant proteins targeted to peroxisomes or ER

    • ACBD5 FFAT motif mutants that cannot bind VAPB

    • VAPB expression alone (for co-expression studies)

  • Domain-specific controls:

    • ACB domain mutants (maintain tethering but disrupt lipid binding)

    • FFAT motif mutants (disrupt tethering but maintain lipid binding)

    • These allow attribution of observed effects to specific protein functions

  • Expression level controls:

    • Western blot confirmation of protein expression levels

    • Titration of expression vectors to achieve comparable levels

    • Inducible expression systems for controlled protein levels

  • Functional readout controls:

    • Measurement of peroxisome mobility as an indirect indicator of tethering

    • Assessment of multiple tethering metrics (Mean attachment and Mean ER contact)

    • Analysis of downstream metabolic effects (VLCFA levels)

  • System validation controls:

    • Comparison of ACBD5 knockout with ACBD5 silencing

    • Testing for compensatory effects (e.g., ACBD4 upregulation in ACBD5 knockout)

    • Multiple cell lines to ensure generalizability of findings

By incorporating these controls, researchers can distinguish between effects specifically due to ACBD5-mediated tethering versus indirect or non-specific effects, ensuring robust and reproducible findings in this complex area of research.

How can advanced imaging techniques enhance our understanding of ACBD5-mediated organelle interactions?

Advanced imaging techniques offer powerful approaches to explore the dynamic nature of ACBD5-mediated peroxisome-ER interactions at unprecedented spatial and temporal resolution:

  • Super-resolution microscopy:

    • Stimulated emission depletion (STED) microscopy

    • Photoactivated localization microscopy (PALM)

    • Stochastic optical reconstruction microscopy (STORM)

    • These techniques can resolve membrane contact sites below the diffraction limit, providing detailed visualization of peroxisome-ER interfaces

  • Live-cell imaging approaches:

    • Lattice light-sheet microscopy for long-term imaging with minimal phototoxicity

    • Single-particle tracking of peroxisomes to quantify mobility changes related to tethering

    • FRET-based sensors to detect protein-protein interactions in real-time

    • Optogenetic tools to manipulate tethering on demand

  • Correlative light and electron microscopy (CLEM):

    • Combining fluorescence microscopy with electron microscopy

    • Direct visualization of membrane contact sites at ultrastructural level

    • Immunogold labeling of ACBD5 and VAPB to pinpoint their localization at contact sites

  • Quantitative image analysis:

    • Machine learning algorithms for automated detection of organelle contacts

    • 3D reconstruction of peroxisome-ER interfaces

    • Time-series analysis to capture dynamic changes in tethering

  • Advanced functional imaging:

    • Fluorescent lipid probes to track lipid transfer at contact sites

    • Local calcium indicators to monitor ion concentration changes at interfaces

    • Fluorescence recovery after photobleaching (FRAP) to assess protein mobility at contact sites

These advanced imaging approaches can address key questions about ACBD5-mediated interactions, such as: How does phosphorylation dynamically regulate contact formation? Does lipid binding by the ACB domain affect local membrane composition? What is the three-dimensional architecture of peroxisome-ER contact sites? Integration of these imaging methods with molecular and biochemical approaches can provide comprehensive insights into the structural and functional aspects of ACBD5-mediated organelle tethering.

What is the evolutionary significance of ACBD5 function across different species?

Understanding the evolutionary aspects of ACBD5 function can provide insights into its fundamental biological importance and specialized adaptations across species:

  • Comparative genomics approaches:

    • Phylogenetic analysis of ACBD5 across evolutionary lineages

    • Comparison between Pongo abelii (orangutan) ACBD5 and orthologs in other primates, mammals, and vertebrates

    • Analysis of selective pressure on different domains (ACB domain vs. FFAT motif)

    • Identification of conserved regulatory elements

  • Functional conservation assessment:

    • Cross-species complementation studies (e.g., can human ACBD5 rescue yeast mutants lacking related proteins?)

    • Comparative biochemical analysis of ACBD5 from different species

    • Evaluation of VAPB-binding capacity across evolutionary diverse ACBD5 proteins

  • Model organism studies:

    • Generation and characterization of ACBD5 mutants in model organisms (zebrafish, Drosophila, C. elegans)

    • Analysis of peroxisome-ER contacts in these models

    • Assessment of metabolic and developmental phenotypes

  • Correlation with metabolic specializations:

    • Comparison of ACBD5 structure and function in species with different metabolic demands

    • Analysis of ACBD5 in hibernating mammals or other metabolically specialized organisms

    • Investigation of tissue-specific adaptations of ACBD5 function

Evolutionary studies can reveal whether ACBD5-mediated peroxisome-ER tethering is an ancestral function or a more recent adaptation, and how its dual roles in organelle tethering and lipid metabolism have been shaped by different selective pressures across species. This evolutionary perspective may highlight unconventional aspects of ACBD5 function that are not immediately apparent from studies in standard laboratory models.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.