Recombinant Pongo abelii ADP-ribosylation factor-like protein 6-interacting protein 1 (ARL6IP1)

What is ARL6IP1 and what are its fundamental functions?

ARL6IP1, also known as ADP-ribosylation factor-like protein 6-interacting protein 1, Aip-1, or Protein TBX2, is a membrane protein encoded by the ARL6IP1 gene . The protein plays a critical role in endoplasmic reticulum (ER) organization and autophagy processes. Specifically, ARL6IP1 is involved in FAM134B-dependent ER-phagy, a selective autophagy process targeting portions of the endoplasmic reticulum .

Research with knockout models has demonstrated that ARL6IP1 is essential for proper sensory fiber development and function. When ARL6IP1 is absent, sensory fiber degeneration occurs along with a substantial loss of sensory amplitudes in peripheral nerves . This indicates its importance in neurological function, particularly in sensory neurons.

How is ARL6IP1 structurally characterized?

Pongo abelii ARL6IP1 consists of 203 amino acids with a specific sequence starting with MAEGDNRSSN and ending with KQKEKKNE . The protein contains transmembrane domains that integrate into the ER membrane. The full amino acid sequence is:

MAEGDNRSSNLLAEETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIY YLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTEQQQRFHEICSNLVKTRRRAV GWWKRLFTLKEEKPKMYFMTMIVSLAAVAWVGQQVHNLLLTYLIVTSLLLLPGLNQHGII SKYIGMAKREINKLLKQKEKKNE

Structural analysis indicates that ARL6IP1 possesses regions that can interact with other proteins involved in ER morphology and autophagy pathways. Its transmembrane domains are crucial for its localization and function within the ER membrane system.

What cellular pathways involve ARL6IP1?

ARL6IP1 is primarily involved in:

• ER-phagy pathways: ARL6IP1 participates in FAM134B-dependent ER-phagy, which is essential for maintaining ER homeostasis .

• Ubiquitination processes: ARL6IP1 undergoes ubiquitination by AMFR (Autocrine Motility Factor Receptor), particularly at lysine residues K96 and K114. This ubiquitination increases during ER stress conditions and appears to be functionally significant .

• Neuronal maintenance: ARL6IP1's presence in peripheral nerves and its impact on sensory function suggests involvement in neuronal maintenance and function, particularly in sensory neurons .

The interaction between ARL6IP1 and FAM134B is promoted by AMFR, indicating a complex regulatory network governing ER-phagy processes .

How does ARL6IP1 contribute to ER-phagy mechanisms?

ARL6IP1 functions as part of ER-phagy complexes alongside other proteins such as FAM134B . The mechanism appears to involve:

• Heteromeric cluster formation: ARL6IP1 forms part of heteromeric clusters of ubiquitinated ER-shaping proteins that drive ER-phagy .

• AMFR-dependent ubiquitination: ARL6IP1 is ubiquitinated by AMFR, which appears to be a key regulatory step in its function. The ubiquitination occurs predominantly at lysine residues K96 and K114 .

• Stress-responsive regulation: Ubiquitination of endogenous ARL6IP1 increases following induction of ER stress, suggesting a role in stress-responsive ER remodeling .

Methodologically, studying these interactions requires careful co-immunoprecipitation experiments, ubiquitination assays, and structural analysis of protein complexes through techniques like proximity ligation assays or fluorescence resonance energy transfer (FRET).

What phenotypes are observed in ARL6IP1 knockout models?

Knockout models of ARL6IP1 demonstrate several significant phenotypes:

• Sensory fiber degeneration: ARL6IP1 KO mice show substantial degeneration of sensory fibers .

• Electrophysiological deficits: Loss of sensory amplitudes in peripheral nerves is evident in electrophysiological analyses .

• Ultrastructural abnormalities: Peripheral nerves show swollen axons containing dysfunctional organelles and tubulofilamentous material .

• ER morphology changes: Notable ladder-like expansions of transverse ER sheet structures are observed, similar to phenotypes reported for mice mutant for both ALT1 and REEP1 .

• Cell body effects: Dorsal root ganglia (sensory neuron cell bodies) exhibit substantial expansion of ER sheets .

These phenotypes correlate with clinical observations in patients with sensory loss and diminished pain perception, suggesting translational relevance of ARL6IP1 research .

How does ubiquitination regulate ARL6IP1 function?

The ubiquitination of ARL6IP1 appears to be a critical regulatory mechanism:

• Site-specific modification: ARL6IP1 is specifically ubiquitinated at K96 and K114 residues by AMFR .

• RING domain dependence: The interaction requires the active RING domain of AMFR, as catalytically inactive AMFR-C356G-H361A variant (AMFR RINGmut) fails to mediate this ubiquitination .

• Interaction promotion: Ubiquitination appears to promote the interaction between ARL6IP1 and FAM134B, suggesting it may serve as a molecular switch for complex formation .

• Stress responsiveness: Endogenous ARL6IP1 ubiquitination increases following ER stress induction, indicating this modification is part of cellular stress response mechanisms .

Methodologically, studying these modifications requires mass spectrometry approaches, mutational analysis of key lysine residues, and in vitro ubiquitination assays using purified components.

What expression systems are optimal for Recombinant Pongo abelii ARL6IP1 production?

For optimal expression of Recombinant Pongo abelii ARL6IP1:

• E. coli expression systems: Can be used for high-yield production, but proper folding may be challenging due to the membrane protein nature of ARL6IP1. Consider using specialized strains designed for membrane protein expression.

• Mammalian expression systems: HEK293 or CHO cells often provide better folding for mammalian proteins. This is particularly important when studying interaction with other proteins.

• Insect cell systems: Baculovirus expression in Sf9 or Hi5 cells offers a compromise between yield and proper folding/post-translational modifications.

The recombinant protein should ideally include an appropriate tag for purification (His, GST, etc.) while ensuring the tag doesn't interfere with protein function. Based on commercial protocols, storage in Tris-based buffer with 50% glycerol at -20°C is recommended for the purified protein .

What purification strategies are most effective for maintaining ARL6IP1 activity?

When purifying Recombinant Pongo abelii ARL6IP1:

• Membrane protein considerations: As ARL6IP1 is membrane-associated, detergent selection is critical. Mild detergents like DDM, LMNG, or digitonin can help maintain native structure.

• Affinity chromatography: Using the protein's tag (His, GST, etc.) for initial capture, followed by additional purification steps.

• Size exclusion chromatography: Essential for separating monomeric from aggregated protein and removing contaminants.

• Buffer optimization: The final buffer should contain stabilizing agents. For ARL6IP1, a Tris-based buffer with 50% glycerol has been shown to be effective .

• Storage recommendations: Store at -20°C for general use, or at -80°C for extended storage. Avoid repeated freeze-thaw cycles which can degrade the protein's activity .

For functional studies, validation that the purified protein retains its ability to interact with known binding partners (such as FAM134B or AMFR) is recommended.

What experimental approaches best characterize ARL6IP1 interactions?

To characterize ARL6IP1 interactions with other proteins:

• Co-immunoprecipitation: Effective for identifying protein-protein interactions. This has been used successfully to demonstrate ARL6IP1's interaction with FAM134B and AMFR .

• Proximity ligation assays: Useful for confirming interactions in situ within cells.

• Fluorescence microscopy: Using fluorescently-tagged proteins to track co-localization. C-terminal fluorescent tags of ARL6IP1 have been used effectively in trypsin protection assays .

• FRET/BRET assays: For quantitative analysis of direct protein interactions and their dynamics.

• Split-GFP complementation: Can be particularly useful for membrane proteins like ARL6IP1.

• Ubiquitination assays: Co-expression of Myc-ubiquitin with ARL6IP1 and AMFR, followed by pull-down and western blotting, has successfully demonstrated the ubiquitination of ARL6IP1 .

For all interaction studies, proper controls are essential, including catalytically inactive mutants (like AMFR RINGmut) to demonstrate specificity .

How should researchers interpret ARL6IP1 knockout phenotypes in relation to human disease?

When analyzing ARL6IP1 knockout phenotypes:

• Translational relevance: The sensory fiber degeneration and electrophysiological deficits in ARL6IP1 KO mice correlate with clinical observations in patients with sensory loss and diminished pain perception .

• Pathway analysis: Consider the broader ER-phagy pathway rather than ARL6IP1 in isolation. The phenotypic similarity to ALT1/REEP1 double mutants suggests overlapping functional pathways .

• Tissue-specific effects: Focus particularly on neuronal tissues, especially sensory neurons, where ARL6IP1 disruption shows the most pronounced effects .

• ER morphology changes: Quantitative analysis of ER sheet expansion in various cell types can provide insights into cell-type specific vulnerability to ARL6IP1 loss .

• Comparative phenotyping: Compare phenotypes with other ER-phagy component knockouts (e.g., FAM134B) to establish pathway relationships and hierarchy.

The interpretation should consider both cell-autonomous effects in neurons and potential non-cell-autonomous effects in surrounding tissues when evaluating relevance to human pathology.

What bioinformatic approaches are valuable for analyzing ARL6IP1 evolutionary conservation?

For evolutionary analysis of ARL6IP1:

• Multiple sequence alignment: Compare ARL6IP1 sequences across species, particularly focusing on primates like Pongo abelii versus human sequences to identify conserved domains.

• Phylogenetic analysis: Construct phylogenetic trees to understand the evolutionary relationships and selection pressures on ARL6IP1.

• Domain conservation analysis: Examine conservation patterns across different protein domains, with particular attention to transmembrane regions and interaction interfaces.

• Selection pressure analysis: Calculate dN/dS ratios to identify regions under positive or purifying selection.

• Structural prediction: Use homology modeling to predict structural conservation when crystal structures are unavailable.

The Pongo abelii ARL6IP1 (UniProt: Q5R454) sequence provides a valuable reference point for primates , allowing researchers to investigate evolutionary changes that may impact protein function in different species.

How can contradictory findings about ARL6IP1 function be reconciled across different experimental systems?

When facing contradictory findings regarding ARL6IP1 function:

• Cell type considerations: Determine whether differences stem from cell-type specific functions of ARL6IP1. The protein shows particularly important functions in sensory neurons .

• Interaction partner availability: Assess whether key interaction partners (FAM134B, AMFR) are expressed at different levels across experimental systems, which could affect observed functions.

• Stress conditions: Consider whether contradictions relate to different cellular stress states, as ARL6IP1 ubiquitination increases under ER stress .

• Methodological differences: Evaluate whether different methods of protein depletion (siRNA vs. CRISPR knockout vs. dominant negative) might explain varying results.

• Species differences: Compare results across species, considering that while core functions may be conserved between human and Pongo abelii ARL6IP1, regulatory mechanisms might differ.

A systematic meta-analysis approach, tabulating experimental conditions alongside outcomes, can help identify patterns explaining seemingly contradictory results.

What quality control measures are essential when working with recombinant ARL6IP1?

Essential quality control measures include:

• Purity assessment: SDS-PAGE and mass spectrometry to confirm protein identity and purity.

• Structural integrity: Circular dichroism spectroscopy to verify proper protein folding, particularly important for membrane proteins like ARL6IP1.

• Activity validation: Functional assays demonstrating the protein's ability to interact with known partners like FAM134B or undergo ubiquitination by AMFR .

• Storage stability: Regular testing of stored protein to ensure it maintains activity over time. Repeated freeze-thaw cycles should be avoided .

• Batch consistency: Comparison between different production batches to ensure reproducibility.

For Pongo abelii ARL6IP1, verification that the recombinant protein contains the complete 203 amino acid sequence is particularly important .

What are the best approaches for studying ARL6IP1 in cellular models?

For cellular studies of ARL6IP1:

• Expression systems: Consider using neuronal cell lines or primary sensory neurons for physiologically relevant contexts, given ARL6IP1's importance in these cells .

• Visualization strategies: C-terminal fluorescent tagging of ARL6IP1 has been successfully employed, though researchers should verify that tagging doesn't interfere with function .

• Knockout/knockdown comparison: Both methods may yield different results due to acute versus chronic protein loss. CRISPR-Cas9 editing can provide complete knockout, while RNAi approaches allow for temporal control.

• Stress induction protocols: As ARL6IP1 function relates to ER stress responses, carefully controlled ER stress induction (e.g., tunicamycin, thapsigargin) can reveal functional aspects .

• Co-expression studies: Investigating ARL6IP1 alongside its interaction partners FAM134B and AMFR provides more complete understanding of its function in ER-phagy .

Trypsin protection assays have proven useful for studying the topology of ARL6IP1, with C-terminal fluorescent tags being accessible to trypsin while luminal proteins remain protected .

What are promising therapeutic approaches targeting ARL6IP1-related pathways?

Potential therapeutic approaches include:

• Modulation of ER-phagy: Small molecules that enhance or regulate ER-phagy might compensate for ARL6IP1 dysfunction.

• Targeting ubiquitination: Since ubiquitination by AMFR is key for ARL6IP1 function, modulating this process could offer therapeutic potential .

• Gene therapy approaches: For hereditary sensory neuropathies related to ARL6IP1 dysfunction, gene replacement strategies might be considered.

• ER stress modulators: Compounds that modulate ER stress responses could provide therapeutic benefit in conditions where ARL6IP1 function is compromised.

• Neuroprotective strategies: Given the importance of ARL6IP1 in sensory neurons, broader neuroprotective approaches might mitigate the consequences of its dysfunction .

Development of such therapeutics would require detailed understanding of the structural basis for ARL6IP1 interactions and its precise role in neuronal maintenance.

What emerging technologies could advance ARL6IP1 research?

Emerging technologies with potential to advance ARL6IP1 research include:

• Cryo-EM for membrane protein complexes: Could elucidate the structure of ARL6IP1 within ER membranes and its interaction with partners.

• Optogenetic control of ER-phagy: Light-controlled activation/inhibition of ARL6IP1 or its partners could provide temporal resolution of pathway dynamics.

• Single-cell proteomics: For analyzing cell-type specific differences in ARL6IP1 complex formation and function.

• Organoid models: Brain or sensory neuron organoids could provide more physiologically relevant models for studying ARL6IP1 function.

• In vivo imaging of ER dynamics: Advanced microscopy techniques for visualizing ER-phagy in live animals could connect molecular mechanisms to physiological outcomes.

These approaches could help resolve current knowledge gaps about ARL6IP1's precise role in ER-phagy and neuronal maintenance.