Recombinant Pongo abelii ADP/ATP translocase 2 (SLC25A5)

Shipped with Ice Packs
In Stock

Description

Introduction to ADP/ATP Translocase 2

ADP/ATP translocase 2, encoded by the SLC25A5 gene, functions as a critical antiporter that facilitates the exchange of ADP and ATP between the mitochondrial matrix and cytoplasm. This protein plays a fundamental role in cellular energy metabolism by maintaining mitochondrial membrane potential and regulating apoptotic processes . The SLC25A5 gene belongs to the adenine nucleotide translocator (ANT) family, which itself is part of a larger superfamily that includes genes encoding mitochondrial uncoupling proteins and phosphate carrier proteins .

While the human variant has been extensively studied, the Pongo abelii (Sumatran orangutan) version shares significant sequence homology due to the close evolutionary relationship between humans and orangutans. Recombinant production of this protein enables detailed investigation of its properties and functions in controlled laboratory settings, providing valuable insights into primate energy metabolism and potential therapeutic applications.

Evolutionary Context and Conservation

The SLC25A5 gene is highly conserved across mammalian species, reflecting its essential role in cellular energy homeostasis. As a member of the solute carrier family 25, which encodes transport proteins located at the inner mitochondrial membrane, ADP/ATP translocase 2 represents a critical component of the mitochondrial machinery involved in metabolite transport . The conservation of this protein across species underscores its fundamental importance in cellular metabolism and survival.

In Pongo abelii, as in humans, the protein is likely expressed in tissues with high energy demands, where it facilitates the exchange of cytosolic ADP for mitochondrially generated ATP, thereby supplying the energy currency required for numerous cellular processes. The recombinant form provides researchers with access to purified protein for detailed structural and functional studies.

Gene and Protein Structure

The SLC25A5 gene, which encodes ADP/ATP translocase 2, consists of 4 exons in humans, and a similar structure is expected in Pongo abelii . The protein forms a homodimer embedded within the inner mitochondrial membrane, comprised of approximately 300-320 amino acid residues that fold into six transmembrane helices . This structural arrangement creates the channel through which adenine nucleotides are transported across the mitochondrial inner membrane.

The human protein has a predicted molecular weight of approximately 32.7 kDa , and the Pongo abelii version likely has a similar molecular weight given the high degree of conservation. The amino acid sequence contains specific motifs that are critical for nucleotide binding and transport, including regions that interact with regulatory molecules such as SIRT4.

Sequence Features and Domains

Based on homology with the human protein, the Pongo abelii ADP/ATP translocase 2 likely contains several conserved domains and motifs that are essential for its function. These include nucleotide-binding sites, transmembrane domains, and regions involved in protein-protein interactions. The protein sequence is characterized by specific amino acid residues that determine substrate specificity and transport kinetics.

Table 1: Predicted Structural Features of Pongo abelii ADP/ATP Translocase 2

FeatureDescriptionFunctional Significance
Transmembrane DomainsSix helical domains spanning the inner mitochondrial membraneForms the channel for nucleotide transport
Nucleotide Binding SitesSpecific residues that interact with ADP and ATPDetermines substrate specificity and binding affinity
Dimerization InterfaceRegions involved in homodimer formationStabilizes protein structure and facilitates transport
Regulatory SitesMotifs targeted by post-translational modificationsModulates transport activity in response to cellular signals
N-terminal DomainRegion facing the intermembrane spaceInvolved in initial substrate recognition
C-terminal DomainRegion facing the matrixInvolved in substrate release

Primary Transport Function

The primary function of ADP/ATP translocase 2 is to catalyze the exchange of cytosolic ADP for mitochondrial ATP, serving as a major constituent of the mitochondrial permeability-transition pore complex . This antiporter function maintains mitochondrial membrane potential by regulating ADP/ATP ratios during oxidative phosphorylation . The protein facilitates the transport of newly synthesized ATP from the mitochondrial matrix to the cytosol, where it is utilized for various energy-requiring cellular processes.

In the context of Pongo abelii, this function is likely conserved, given the essential nature of ATP production for cellular viability across mammalian species. The recombinant form provides a valuable tool for studying the kinetics and specificity of this transport process in controlled experimental settings.

Regulatory Roles and Additional Functions

Beyond its primary transport function, ADP/ATP translocase 2 plays several regulatory roles in cellular metabolism and homeostasis. It facilitates uncoupling of the mitochondrial membrane when acylated by SIRT4, which can influence energy production and thermogenesis . Interestingly, despite the fact that uncoupling typically promotes apoptosis, ADP/ATP translocase 2 has been found to exhibit antiapoptotic properties .

The protein also serves as a regulator of mitophagy independently of its ADP/ATP antiporter activity, promoting this process through interaction with TIMM44 and subsequently inhibiting the presequence translocase TIMM23 . This interaction leads to the stabilization of PINK1, a key protein involved in mitochondrial quality control. Additionally, as part of the mitotic spindle-associated MMXD complex, ADP/ATP translocase 2 may contribute to chromosome segregation during cell division .

Table 2: Functional Roles of ADP/ATP Translocase 2

FunctionMechanismCellular Impact
ADP/ATP ExchangeAntiporter activity translocating ADP into and ATP out of mitochondriaMaintains cellular energy supply
Mitochondrial Membrane PotentialRegulation of ADP/ATP ratios in oxidative phosphorylationSupports efficient energy production
Proton TransportActs as a proton transporter when activatedContributes to mitochondrial thermogenesis
Mitophagy RegulationInteraction with TIMM44 to inhibit TIMM23Promotes mitochondrial quality control
Apoptosis RegulationInhibition of apoptotic pathwaysPromotes cell survival
Chromosome SegregationComponent of the MMXD complexSupports proper cell division

Expression Systems

Recombinant Pongo abelii ADP/ATP translocase 2 can be produced using various expression systems, with mammalian cell lines such as HEK293T being particularly suitable due to their ability to perform appropriate post-translational modifications . The expression of functional mitochondrial membrane proteins requires careful consideration of the host system to ensure proper folding and insertion into membranes.

The recombinant protein is typically produced with fusion tags such as C-Myc/DDK to facilitate purification and detection . These tags can be strategically placed to minimize interference with protein function while maximizing purification efficiency. The expression construct typically includes the complete coding sequence of the SLC25A5 gene from Pongo abelii, optimized for expression in the chosen host system.

Evolutionary Studies and Comparative Biology

Recombinant Pongo abelii ADP/ATP translocase 2 provides a valuable tool for comparative studies between human and non-human primates. Such comparisons can reveal evolutionary adaptations in energy metabolism that may have occurred during primate evolution. Understanding these differences can provide insights into species-specific metabolic requirements and adaptations.

Biomedical Research Applications

The recombinant protein has significant potential applications in biomedical research, particularly in studies focused on mitochondrial diseases, cancer, and metabolic disorders. Given that suppression of ADP/ATP translocase 2 expression has been shown to induce apoptosis and inhibit tumor growth in human studies , the orangutan ortholog could provide comparative insights into potential therapeutic approaches.

Additionally, the protein's role in the mitochondrial permeability transition pore (mPTP) makes it relevant to research on cell death mechanisms and mitochondrial dysfunction . The ongoing debate regarding the essential nature of ADP/ATP translocase in mPTP formation highlights the importance of comparative studies using orthologs from different species to elucidate conserved and divergent aspects of this process.

Functional Differences and Similarities

While the primary function of ADP/ATP translocase 2 is likely conserved between human and orangutan versions, subtle differences in transport kinetics, regulatory mechanisms, or protein-protein interactions may exist. These differences could reflect adaptations to species-specific metabolic requirements or cellular environments.

Comparative functional studies using recombinant proteins from both species could elucidate these potential differences and their physiological significance. Such studies contribute to our understanding of the evolution of energy metabolism in primates and may reveal species-specific adaptations.

Table 4: Comparative Features of Human and Pongo abelii ADP/ATP Translocase 2

FeatureHuman ADP/ATP Translocase 2Predicted Pongo abelii ADP/ATP Translocase 2
Gene LocationX chromosome (Xq24) Likely similar chromosomal position
Protein Length300-320 amino acids Expected to be similar to human
Molecular Weight32.7 kDa Likely similar to human
Transmembrane DomainsSix helical domains Expected to contain six helical domains
Primary FunctionADP/ATP exchange across inner mitochondrial membrane Likely conserved function
Secondary FunctionsMitochondrial uncoupling, apoptosis regulation, mitophagy regulation Expected to have similar secondary functions
Protein InteractionsSIRT4, TIMM44, MMXD complex Likely to maintain key interactions

Comparative Studies Across Primate Species

Expanding comparative studies to include ADP/ATP translocase 2 from multiple primate species would provide a broader evolutionary perspective on this essential protein. Such studies could identify patterns of conservation and divergence that correlate with metabolic adaptations or environmental pressures across the primate lineage.

Integrating these protein-level analyses with genomic, transcriptomic, and metabolomic data would provide a comprehensive understanding of the evolution of mitochondrial energy metabolism in primates. This multidisciplinary approach could reveal how variations in ADP/ATP translocase 2 contribute to species-specific metabolic characteristics and adaptations.

Therapeutic Applications and Biotechnology

The potential role of ADP/ATP translocase 2 in diseases such as cancer and mitochondrial disorders suggests possible therapeutic applications for modulators of its activity. Comparative studies using the recombinant Pongo abelii protein alongside its human counterpart could facilitate the development of specific modulators with therapeutic potential.

Additionally, the recombinant protein could be utilized in biotechnological applications, such as the development of biosensors for adenine nucleotides or as a component of artificial cellular systems designed to study energy metabolism. The availability of purified, functional protein enables such innovative applications and expands the toolbox for research and development in this field.

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify any format requirements in your order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted as needed.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
SLC25A5; ADP/ATP translocase 2; ADP,ATP carrier protein 2; Adenine nucleotide translocator 2; ANT 2; Solute carrier family 25 member 5
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-298
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
TDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVRI PKEQGVLSFWRGNLANVIRHFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASGG AAGATSLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVSV QGIIIYRAAYFGIYDTAKGMLPDPKNTHIVISWMIAQTVTAVAGLTSYPFDTVRRRMMMQ SGRKGTDIMYTGTLDCWRKIARDEGGKAFFKGAWSNVLRGMGGAFALVLYDEIKKYT
Uniprot No.

Target Background

Function
ADP/ATP translocase 2 (SLC25A5) is an inner mitochondrial membrane antiporter mediating the import of ADP into the mitochondrial matrix for ATP synthesis and the export of ATP to fuel cellular processes. It functions via an alternating access mechanism with a single substrate-binding site, cycling between cytoplasmic-open (c-state) and matrix-open (m-state) conformations. Beyond its ADP/ATP antiport activity, SLC25A5 is involved in mitochondrial uncoupling and permeability transition pore (mPTP) activity. It acts as a proton transporter, uncoupling proton flow through the electron transport chain and ATP synthase, thereby reducing ATP production efficiency and promoting mitochondrial thermogenesis. This proton transport activity is inhibited by ADP/ATP antiport activity, suggesting SLC25A5 acts as a regulator of mitochondrial energy balance between ATP production and thermogenesis. Free fatty acids are required as a cofactor for proton transport. SLC25A5 is also implicated in mPTP opening, facilitating the passage of solutes up to 1.5 kDa and contributing to cell death, although its precise role in mPTP formation or regulation remains unclear. Independent of its ADP/ATP antiport activity, SLC25A5 regulates mitophagy by interacting with TIMM44, inhibiting TIMM23, and promoting PINK1 stabilization. As a component of the mitotic spindle-associated MMXD complex, it may also participate in chromosome segregation.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein. Membrane; Multi-pass membrane protein.

Q&A

How does SLC25A5 function in mitochondrial energy metabolism?

SLC25A5 (also known as ANT2) serves as an ADP/ATP antiporter that mediates the import of ADP into the mitochondrial matrix for ATP synthesis and export of ATP to the cytoplasm to fuel cellular processes . The protein operates through an alternating access mechanism with a single substrate-binding site that is intermittently exposed to either the cytosolic side (c-state) or matrix side (m-state) of the inner mitochondrial membrane .

Beyond its primary nucleotide transport function, SLC25A5 plays a dual role in mitochondrial physiology:

  • Energy production: Functions as an ADP/ATP antiporter to support ATP synthesis

  • Thermogenesis: Acts as a proton transporter that uncouples electron transport from ATP synthesis

This dual functionality positions SLC25A5 as a master regulator of mitochondrial energy output, maintaining a delicate balance between ATP production and thermogenesis . The proton transporter activity requires free fatty acids as cofactors but does not transport them directly .

What are the optimal storage and handling conditions for recombinant SLC25A5?

For maximum stability and activity of recombinant Pongo abelii SLC25A5, observe the following storage and handling protocols:

Storage ConditionRecommendationDuration
Short-term storage4°CUp to one week
Standard storage-20°CMonths
Long-term storage-80°CYears

The protein is typically supplied in a Tris-based buffer containing 50% glycerol, optimized to maintain stability . Repeated freezing and thawing cycles should be strictly avoided as they lead to protein denaturation and activity loss . For experimental work spanning multiple days, prepare small working aliquots to minimize freeze-thaw cycles.

When diluting the protein for experiments, maintain a minimum glycerol concentration of 10% to preserve stability, unless the experimental protocol specifically requires lower concentrations .

How can researchers effectively study SLC25A5's role in mitochondrial permeability transition pore (mPTP) formation?

SLC25A5 plays a key role in mPTP activity, which enables the passage of molecules up to 1.5 kDa across mitochondrial membranes during cellular stress . To investigate this function, researchers can employ several methodological approaches:

  • Genetic manipulation approaches:

    • Generate stable knockdown/knockout cell lines using siRNA or CRISPR/Cas9 technology

    • Perform rescue experiments with wild-type or mutated recombinant SLC25A5

    • Create chimeric proteins to identify domains involved in mPTP regulation

  • Functional assays:

    • Calcium retention capacity measurements in isolated mitochondria

    • Mitochondrial swelling assays monitoring absorbance changes at 540 nm

    • Cytochrome c release quantification by ELISA or Western blotting

    • Membrane potential assessment using potentiometric dyes (TMRM, JC-1)

  • Structural approaches:

    • Reconstitution of purified SLC25A5 into liposomes or nanodiscs

    • Cross-linking with bifunctional reagents to identify interaction partners

    • Blue native PAGE to identify native protein complexes

These complementary approaches can address the fundamental question of whether SLC25A5 constitutes a pore-forming component of mPTP or functions as a regulatory protein .

How is SLC25A5 involved in adipogenesis regulation, and what experimental approaches can reveal its mechanism?

Recent research has identified SLC25A5 as a significant regulator of adipogenesis . Transcriptomic and lipidomic analyses revealed that SLC25A5 expression is significantly upregulated during adipogenic differentiation in mouse models . Experimental evidence demonstrates that:

  • Depletion effects: SLC25A5 knockdown leads to:

    • Suppressed expression of adipogenesis-related genes

    • Reduced triglyceride accumulation

    • Inhibited PPARγ protein expression

    • Decreased oxidative phosphorylation protein expression (ATP5A1, CQCRC2, MTCO1)

    • Reduced ATP production

  • Signaling pathway involvement: The adipogenic differentiation inhibition appears to be mediated through ERK1/2 phosphorylation, confirmed through intervention with PD98059 (an ERK1/2 inhibitor)

To investigate this mechanism, researchers can employ the following protocol:

Protocol for studying SLC25A5 in adipogenesis:

a) Cell culture preparation:

  • Culture preadipocytes (e.g., OP9 cells or adipose-derived stem cells) to 50-70% confluence

  • Transfect with SLC25A5 siRNA (10 nM) or negative control siRNA using appropriate transfection reagent

  • Incubate for 24 hours before replacing media with adipogenic differentiation medium

b) Analytical methods:

  • Oil Red O staining to visualize and quantify lipid accumulation

  • Western blotting for adipogenic markers (PPARγ) and OXPHOS proteins

  • RT-qPCR to measure expression of adipogenesis-related genes

  • ATP production assays to assess metabolic effects

  • ERK pathway analysis using phospho-specific antibodies

This research suggests SLC25A5 could represent a novel therapeutic target for obesity treatment through its role in regulating adipogenesis .

What roles does SLC25A5 play in respiratory epithelium, and how can it be studied in airway disease models?

SLC25A5 (ANT2) has been identified as a protective factor in airway epithelial metabolism, particularly in the context of cigarette smoke exposure and chronic obstructive pulmonary disease (COPD) . Gene expression studies show ANT2 is reduced in lung tissue from COPD patients and in mouse smoking models .

Research demonstrates that overexpression of ANT proteins results in:

  • Enhanced oxidative respiration and ATP flux

  • Stimulated airway surface hydration by ATP

  • Maintained ciliary beating after exposure to cigarette smoke

In addition to mitochondrial localization, ANT proteins have been found at the plasma membrane in airway epithelial cells, suggesting a direct role in regulating airway homeostasis .

Experimental approaches for studying SLC25A5 in airway models:

  • Cell models:

    • Primary human bronchial epithelial cells

    • Air-liquid interface cultures to mimic physiological conditions

    • Exposure to cigarette smoke extract to model environmental stress

  • Functional assays:

    • Ciliary beat frequency measurement using high-speed video microscopy

    • Airway surface liquid height assessment

    • ATP release quantification using luciferase-based assays

    • Mitochondrial respiration analysis using Seahorse XF technology

  • In vivo models:

    • Transgenic mice with altered SLC25A5 expression

    • Cigarette smoke exposure models

    • Measurement of respiratory parameters and ciliary function

This research highlights the potential for SLC25A5 upregulation or agonist development as a therapeutic strategy for protecting against dysfunctional mitochondrial metabolism, impaired airway hydration, and reduced ciliary motility in COPD .

How does SLC25A5 differ functionally from other members of the SLC25 family, particularly SLC25A4?

The SLC25 family encompasses multiple adenine nucleotide translocases with distinct tissue distribution and specialized functions. Comparative analysis of SLC25A5 (ANT2) and SLC25A4 (ANT1) reveals both shared mechanisms and unique properties:

FeatureSLC25A5 (ANT2)SLC25A4 (ANT1)
Primary functionADP/ATP exchange across mitochondrial membraneADP/ATP exchange across mitochondrial membrane
Tissue distributionBroadly expressedPredominantly in heart and skeletal muscle
Disease associationsPotential role in cancer, obesity, COPDAutosomal dominant progressive external ophthalmoplegia, familial hypertrophic cardiomyopathy
Secondary functionsMitochondrial uncoupling, mitophagy regulation, mPTP activityMitochondrial uncoupling, mitophagy regulation, mPTP activity
Regulatory roleMaster regulator of mitochondrial energy outputSimilar regulatory capabilities but with tissue-specific effects

Both proteins function as ADP/ATP antiporters and proton transporters, contributing to a balance between energy production and thermogenesis . They both interact with TIMM44 to promote mitophagy by inhibiting the presequence translocase TIMM23, thereby stabilizing PINK1 .

The existence of multiple ANT isoforms (SLC25A4, SLC25A5, SLC25A6, and SLC25A31) across species suggests evolutionary adaptation to specific tissue requirements and cellular contexts .

What are the technical considerations for comparing human and Pongo abelii SLC25A5 in functional studies?

  • Sequence comparison:

    • Human SLC25A5 (UniProtKB/Swiss-Prot: P05141)

    • Pongo abelii SLC25A5 (UniProt NO.: Q5R5A1)

    • Alignment analysis to identify conserved and divergent regions

  • Expression system selection:

    • Human SLC25A5 is commonly expressed in HEK-293 cells

    • Recombinant Pongo abelii SLC25A5 can be expressed in various systems including HEK-293 cells

    • Use the same expression system for both proteins to minimize system-dependent variations

  • Tag considerations:

    • Standardize tag type and position (N-terminal vs. C-terminal)

    • Verify that tags do not interfere with protein function

    • Consider tag-free proteins for certain applications

  • Functional assay standardization:

    • Use identical buffer conditions, substrate concentrations, and assay parameters

    • Include internal controls to normalize for experimental variations

    • Perform biological and technical replicates to ensure reproducibility

  • Species-specific factors:

    • Consider potential differences in post-translational modifications

    • Account for species-specific interaction partners

    • Evaluate temperature sensitivity if applicable

By standardizing these experimental variables, researchers can make valid comparisons between human and Pongo abelii SLC25A5, providing insights into evolutionary conservation and species-specific adaptations of this important mitochondrial carrier.

How can SLC25A5 be utilized in studying mitochondrial uncoupling mechanisms?

SLC25A5 plays a crucial role in mitochondrial uncoupling, a process that dissipates the proton gradient to generate heat instead of ATP . This function positions SLC25A5 as a valuable tool for investigating thermogenesis in tissues that do not express the canonical uncoupling protein UCP1 .

Experimental approaches for studying mitochondrial uncoupling through SLC25A5:

  • Bioenergetic analysis:

    • Oxygen consumption measurements in isolated mitochondria or intact cells

    • Simultaneous monitoring of oxygen consumption and extracellular acidification

    • Assessment of coupling efficiency and spare respiratory capacity

    • Proton leak measurements under various substrate conditions

  • Structure-function studies:

    • Site-directed mutagenesis to identify residues critical for proton transport

    • Domain swapping with other SLC25 family members

    • Investigation of fatty acid binding sites and their role in uncoupling

  • Regulatory mechanisms:

    • Analysis of how ADP/ATP antiporter activity inhibits proton transporter function

    • Identification of post-translational modifications affecting this balance

    • Screening for small molecules that modulate the switch between functions

  • Thermogenesis assessment:

    • Direct temperature measurements in cellular models

    • Infrared thermography for spatial resolution of heat production

    • Calorimetric approaches in cellular systems

These methodologies can help elucidate how SLC25A5 maintains the balance between ATP production and thermogenesis, potentially leading to therapeutic approaches for metabolic disorders .

What methodological approaches can resolve the controversy regarding SLC25A5's role in the mitochondrial permeability transition pore?

The precise role of SLC25A5 in mitochondrial permeability transition pore (mPTP) formation remains controversial—whether it constitutes a pore-forming component or functions as a regulatory protein . Resolving this question requires sophisticated methodological approaches:

  • Cryo-electron microscopy:

    • High-resolution structural analysis of mPTP complexes

    • Immunogold labeling to localize SLC25A5 within the complex

    • Tomographic reconstruction of membrane architecture during pore opening

  • Reconstitution experiments:

    • Purification of SLC25A5 and potential mPTP components

    • Reconstitution into artificial membrane systems

    • Electrophysiological characterization of reconstituted channels

    • Systematic omission of components to determine minimal pore requirements

  • Cross-linking and proximity labeling:

    • Chemical cross-linking followed by mass spectrometry

    • BioID or APEX2 proximity labeling to identify proteins in close proximity to SLC25A5 during mPTP activation

    • Fluorescence resonance energy transfer (FRET) to detect conformational changes

  • Genetic approaches:

    • Generation of SLC25A5 variants lacking specific domains

    • Creation of conditional knockout models with temporal control

    • CRISPR/Cas9 gene editing to introduce specific mutations at endogenous loci

  • Real-time imaging techniques:

    • Super-resolution microscopy to visualize dynamic changes in mPTP components

    • Correlation of structural changes with functional parameters

    • Live-cell imaging with genetically encoded sensors for calcium, ROS, and membrane potential

By integrating these approaches, researchers can develop a comprehensive understanding of SLC25A5's precise contribution to mPTP formation and regulation, with implications for cell death mechanisms and potential therapeutic interventions .

What are common technical challenges when working with recombinant SLC25A5, and how can they be addressed?

As a mitochondrial membrane protein, SLC25A5 presents several technical challenges that require specific troubleshooting strategies:

  • Protein solubility and aggregation issues:

    • Challenge: Hydrophobic regions can cause aggregation in aqueous buffers

    • Solution: Include appropriate detergents (0.1-1% CHAPS, DDM, or digitonin); reconstitute into nanodiscs or liposomes; optimize buffer ionic strength; add stabilizing agents like glycerol (as used in commercial preparations)

  • Loss of functional activity:

    • Challenge: Activity loss during purification or storage

    • Solution: Minimize freeze-thaw cycles; store in 50% glycerol as recommended ; avoid oxidizing conditions; include reducing agents; validate activity immediately upon receipt

  • Non-specific binding in interaction studies:

    • Challenge: High background in pull-down or co-immunoprecipitation experiments

    • Solution: Use more stringent washing conditions; pre-clear lysates; include appropriate blocking agents; validate interactions with multiple techniques

  • Inconsistent expression yields:

    • Challenge: Variable expression levels between batches

    • Solution: Optimize codon usage for expression system; use controlled induction protocols; consider different expression systems (HEK-293, E. coli, CFPS)

  • Reproducing physiological conditions:

    • Challenge: Creating an environment that mimics the mitochondrial inner membrane

    • Solution: Use artificial membrane systems with appropriate lipid composition; include physiological concentrations of ions and substrates; account for membrane potential in experimental design

By anticipating these challenges and implementing appropriate solutions, researchers can significantly improve the quality and reproducibility of experiments involving recombinant SLC25A5.

How can researchers validate the functionality of recombinant Pongo abelii SLC25A5 for experimental use?

Before employing recombinant Pongo abelii SLC25A5 in complex experimental setups, researchers should validate its functionality through a systematic approach:

Validation protocol for recombinant SLC25A5:

  • Protein quality assessment:

    • SDS-PAGE to confirm molecular weight (approximately 33 kDa plus tag size)

    • Western blotting with specific antibodies

    • Mass spectrometry to verify sequence integrity

    • Size exclusion chromatography to assess oligomeric state

  • ADP/ATP transport activity:

    • Reconstitution into liposomes loaded with either ADP or ATP

    • Measurement of nucleotide exchange using radiolabeled or fluorescent substrates

    • Determination of transport kinetics (Km, Vmax)

    • Inhibition studies with known ANT inhibitors (atractyloside, bongkrekic acid)

  • Secondary function validation:

    • Assessment of proton transport capability

    • Measurement of calcium-induced mitochondrial swelling

    • Evaluation of membrane potential changes in reconstituted systems

  • Comparative benchmarking:

    • Parallel testing with commercially available standards

    • Comparison with human SLC25A5 under identical conditions

    • Verification against published functional parameters

  • Downstream application testing:

    • Small-scale pilot experiments for intended applications

    • Positive and negative controls to establish dynamic range

    • Dose-response relationships to determine optimal working concentrations

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.