Recombinant Pongo abelii B-cell receptor-associated protein 31 (BCAP31)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, serving as a guideline for your use.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
BCAP31; B-cell receptor-associated protein 31; BCR-associated protein 31; Bap31
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-246
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
SLQWTAVATFLYAEVFVVLLLCIPFISPKRWQKIFKSRLVELVVSYGNTFFVVLIVILVL LVIDAVREIRKYDDVTEKVNLQNNPGAMEHFHMKLFRAQRNLYIAGFSLLLSFLLRRLVT LISQQATLLASNEAFKKQAESASEAAKKYMEENDQLKKGAAVDGGKLDVGNAEVKLEEEN RSLKADLQKLKDELASTKQKLEKAENQVLAMRKQSEGLTKEYDRLLEEHAKLQAAVDGPT DKKEE
Uniprot No.

Target Background

Function

BCAP31 functions as a chaperone protein, ranking among the most abundant endoplasmic reticulum (ER) proteins. It plays a crucial role in the export of secreted proteins from the ER, recognizing misfolded proteins and targeting them for ER-associated degradation (ERAD). It also serves as a cargo receptor for the export of transmembrane proteins. Furthermore, BCAP31 is involved in the assembly of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I) by facilitating the translocation of NDUFS4 and NDUFB11 from the cytosol to the mitochondria via interaction with TOMM40. In response to ER stress, BCAP31 relocates from ER-mitochondria contact sites and binds BCL2. It may also participate in CASP8-mediated apoptosis.

Database Links
Protein Families
BCAP29/BCAP31 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein.

Q&A

What is BCAP31 and what are its primary cellular functions?

BCAP31 (B-cell receptor-associated protein 31) is a member of the B cell receptor family first identified in 1994. It serves two primary functions in cellular biology: mediating the transport of newly formed proteins from the endoplasmic reticulum (ER) to the Golgi apparatus as a carrier molecule, and regulating apoptosis, particularly in pathways mediated by Bcl-2 and Bcl-XL . The BCAP31 gene is located on chromosome Xq28, spans 738 base pairs, and encodes a protein of 246 amino acids with a molecular weight of approximately 28 kDa .

The mature protein contains three transmembrane domains in its amino terminus that anchor it to the ER membrane. The N-terminus is located in the ER lumen, while the C-terminus resides in the cytoplasm where it mediates protein-protein interactions and performs its primary functions of protein transport and apoptosis regulation . As an evolutionarily conserved molecule, BCAP31 participates in the sorting of diverse ER membrane proteins and is involved in the crosstalk between ER and mitochondria during apoptotic processes .

What are the optimal storage and handling conditions for recombinant BCAP31?

Optimal storage and handling of recombinant BCAP31 is critical for maintaining protein stability and functionality in research applications. The following guidelines should be followed:

Reconstitution Protocol:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Addition of glycerol to a final concentration of 5-50% is recommended (with 50% being the standard recommendation)

Storage Conditions:

  • For liquid preparations: 6 months stability at -20°C/-80°C

  • For lyophilized preparations: 12 months stability at -20°C/-80°C

  • Working aliquots can be stored at 4°C for up to one week

Important Considerations:

  • Repeated freezing and thawing is not recommended as it compromises protein integrity

  • Tris-based buffer with 50% glycerol is typically used as a storage buffer

  • Small aliquots should be prepared immediately after reconstitution to minimize freeze-thaw cycles

These conditions ensure maximum protein stability and functional integrity for downstream experimental applications.

How does BCAP31 contribute to cancer cell migration and invasion mechanisms?

BCAP31 has emerged as a significant regulator of cancer cell migration and invasion through several molecular mechanisms:

Epithelial-Mesenchymal Transition (EMT) Regulation:
BCAP31 regulates the epithelial-mesenchymal transition pathway at the transcriptional level. Studies in ovarian cancer have demonstrated that BCAP31 knockdown downregulates the expression of N-cadherin while upregulating E-cadherin expression . This regulation occurs through BCAP31's control of the nuclear aggregation of TWIST1, a transcriptional regulator of both cadherins. While co-immunoprecipitation assays showed no direct interaction between BCAP31 and the cadherins, all three proteins interact with TWIST1 .

Cytoskeletal Reorganization:
In non-small-cell lung cancer (NSCLC), gene set enrichment analysis revealed that cytoskeletal protein and mRNA levels are influenced by BCAP31 expression changes . Immunofluorescence assays demonstrated that cells with altered BCAP31 expression exhibited changes in cell morphology and F-actin distribution, particularly at the cell periphery, suggesting a role in cytoskeletal reorganization that facilitates cell motility .

Functional Impact on Cell Behaviors:
Experimental manipulation of BCAP31 expression in multiple cancer cell lines has consistently demonstrated its functional importance:

  • Depletion of BCAP31 inhibited wound-healing activity

  • BCAP31 knockdown reduced migration and invasion capabilities

  • Overexpression of BCAP31 enhanced these malignant behaviors

These findings collectively establish BCAP31 as a key regulator of cancer cell migration and invasion, acting through both EMT pathway modulation and cytoskeletal reorganization mechanisms.

What experimental approaches are most effective for investigating BCAP31's role in cancer pathogenesis?

Based on successful research methodologies documented in the literature, several experimental approaches have proven effective for investigating BCAP31's role in cancer:

Gene Expression Manipulation:

  • siRNA-Mediated Knockdown:

    • Validated siRNAs targeting BCAP31 (e.g., siRNA ID 138059)

    • Transfection using lipid-based reagents such as Lipofectamine 3000

    • Harvest cells at 2 days post-transfection for functional assays or 4 days for expression analysis

  • Lentiviral Vector-Based Stable Manipulation:

    • For long-term studies, lentiviral vectors carrying BCAP31 shRNA or cDNA

    • Creation of stable cell lines with consistently altered BCAP31 expression

    • Enables extended investigation of phenotypic changes

  • Plasmid Transfection for Overexpression:

    • Expression plasmids containing the full BCAP31 coding sequence

    • Particularly valuable for rescue experiments to confirm specificity

Functional Assays:

  • Migration Assays:

    • Wound-healing (scratch) assays to assess collective cell migration

    • Transwell migration assays to quantify individual cell migration

    • Time-lapse microscopy for dynamic assessment of migration behaviors

  • Invasion Assays:

    • Matrigel-coated Transwell assays to assess invasive capacity

    • 3D culture systems to evaluate invasion in a more physiologically relevant context

  • Molecular Interaction Studies:

    • Co-immunoprecipitation (Co-IP) to detect protein-protein interactions

    • Western blotting for protein expression quantification

    • RT-qPCR for transcriptional regulation assessment

Clinical Correlation:

  • Immunohistochemical staining of patient tumor samples

  • Correlation of expression with clinicopathological features and survival data

  • Analysis of public microarray datasets to validate findings across multiple cohorts

These complementary approaches provide robust evidence for BCAP31's functional roles and molecular mechanisms in cancer pathogenesis.

What is the prognostic significance of BCAP31 expression in different cancer types?

BCAP31 expression demonstrates significant prognostic value across multiple cancer types:

Other Cancer Types:
BCAP31 protein expression is significantly upregulated in several other malignancies compared to adjacent non-cancerous tissues:

  • Malignant melanoma (proposed as an ideal immunotherapy target)

  • Hepatocellular carcinoma

  • Cervical cancer

Interestingly, in colorectal cancer, BCAP31 expression shows a positive association with liver metastasis, though patients with lower BCAP31 expression paradoxically demonstrated significantly reduced survival rates .

These findings establish BCAP31 as an important prognostic biomarker with potential clinical utility for patient stratification and treatment decision-making.

What are the key considerations for designing knockdown and overexpression experiments with BCAP31?

Successful manipulation of BCAP31 expression requires careful experimental design:

Knockdown Strategies:

  • siRNA Selection:

    • Use validated siRNAs targeting conserved regions of BCAP31 (e.g., siRNA ID 138059)

    • Include appropriate negative controls (e.g., cat. no. AM4641)

    • Consider testing multiple siRNA sequences to confirm specificity

  • Transfection Optimization:

    • Determine optimal cell density for each cell line

    • Titrate transfection reagent:siRNA ratio

    • For difficult-to-transfect cells, consider electroporation or nucleofection

    • Perform preliminary time-course experiments to determine optimal harvest times

  • Validation of Knockdown:

    • Confirm reduced expression at both mRNA (RT-qPCR) and protein (western blot) levels

    • Quantify knockdown efficiency (typically aiming for >70% reduction)

    • Monitor potential compensatory expression of related proteins

Overexpression Approaches:

Experimental Controls:

  • Essential Controls:

    • Empty vector/scrambled siRNA controls

    • Wild-type/untransfected controls

    • Rescue experiments (re-expression in knockdown cells) to confirm specificity

  • Timeline Considerations:

    • For transient manipulations: assess functional changes at 48-72 hours post-transfection

    • For stable cell lines: confirm expression stability across multiple passages

    • Consider inducible systems for proteins where constitutive manipulation may be toxic

These methodological considerations ensure robust and reproducible results when investigating BCAP31 function in experimental settings.

How can researchers optimize protein detection and interaction studies involving BCAP31?

Effective detection and characterization of BCAP31 interactions require optimized protocols:

Protein Detection:

  • Western Blotting Optimization:

    • Sample preparation: use buffers containing appropriate protease inhibitors

    • Protein loading: 20-50 μg total protein per lane typically provides good signal

    • Gel concentration: 10-12% SDS-PAGE gels separate BCAP31 (28 kDa) effectively

    • Transfer conditions: wet transfer at 100V for 1 hour or 30V overnight for optimal results

  • Immunoprecipitation Strategies:

    • Use mild lysis buffers to preserve protein-protein interactions

    • Pre-clear lysates to reduce non-specific binding

    • Optimize antibody:bead:lysate ratios through preliminary experiments

    • Include appropriate negative controls (isotype IgG, irrelevant antibodies)

Interaction Studies:

  • Co-Immunoprecipitation (Co-IP):

    • As demonstrated in ovarian cancer studies, Co-IP successfully identified BCAP31's interaction with TWIST1 but not direct binding to E-cadherin or N-cadherin

    • Crosslinking prior to lysis may capture transient interactions

    • Reciprocal Co-IPs provide stronger evidence for specific interactions

  • Proximity Ligation Assays:

    • Provide spatial resolution of protein interactions in situ

    • Particularly valuable for membrane-associated proteins like BCAP31

    • Can detect interactions that may be disrupted during cell lysis

  • Subcellular Fractionation:

    • Critical for distinguishing BCAP31's interactions in different cellular compartments

    • Separate nuclear, cytoplasmic, and membrane fractions

    • Verify fraction purity using compartment-specific markers

Functional Validation of Interactions:

  • Domain Mapping:

    • Generate constructs expressing specific domains of BCAP31

    • Identify regions required for protein-protein interactions

    • Create point mutations in key residues to disrupt specific interactions

  • Transcriptional Impact Assessment:

    • As shown with TWIST1, assess how BCAP31 interactions affect transcriptional regulation

    • Use reporter assays to quantify transcriptional activity

    • Perform ChIP assays to evaluate promoter binding

These optimized approaches enable accurate characterization of BCAP31's molecular interactions and functional consequences in cancer research contexts.

How might BCAP31 function as a potential therapeutic target in cancer treatment?

BCAP31's involvement in cancer progression suggests several potential therapeutic strategies:

Direct Targeting Approaches:

  • RNA Interference Therapeutics:

    • siRNA or shRNA delivery systems targeting BCAP31

    • Clinical development of therapeutic RNA molecules with appropriate delivery vehicles

    • Potential combination with conventional chemotherapy

  • Protein-Protein Interaction Inhibitors:

    • Small molecules disrupting the BCAP31-TWIST1 interaction

    • Peptide mimetics targeting the interaction interface

    • Structure-based drug design focused on critical binding domains

  • Immunotherapeutic Strategies:

    • BCAP31 has been proposed as an ideal target for immunotherapy in malignant melanoma

    • Development of antibody-drug conjugates targeting cell-surface exposed portions

    • CAR-T or other cellular therapies directed against BCAP31-expressing cells

Targeting BCAP31-Mediated Pathways:

  • EMT Pathway Modulation:

    • Combining BCAP31 inhibition with other EMT pathway modulators

    • Dual targeting of BCAP31 and TWIST1 to enhance anti-metastatic effects

    • Monitoring E-cadherin/N-cadherin expression as pharmacodynamic markers

  • ER Stress Exploitation:

    • Given BCAP31's role in protein transport from ER to Golgi, combinatorial approaches with ER stress inducers

    • Potential synergy with proteasome inhibitors

    • Monitoring of unfolded protein response as a biomarker

Biomarker Applications:

  • Patient Stratification:

    • Using BCAP31 expression to identify patients likely to benefit from specific therapies

    • Development of companion diagnostics for BCAP31-targeted treatments

    • Integration with other prognostic markers for enhanced predictive power

  • Treatment Response Monitoring:

    • Evaluating BCAP31 expression changes during treatment

    • Correlation with treatment outcomes and resistance development

    • Potential use as a circulating biomarker if detectable in liquid biopsies

These therapeutic approaches represent promising directions for translating the growing understanding of BCAP31's role in cancer into clinically meaningful interventions.

What are the current limitations and challenges in BCAP31 research?

Despite significant progress, several challenges remain in BCAP31 research:

Technical Limitations:

  • Protein Structure Determination:

    • As a membrane protein, BCAP31's complete structure remains unresolved

    • Challenges in crystallization and structural analysis limit structure-based drug design

    • Need for improved techniques to study membrane protein complexes in their native environment

  • Recombinant Protein Quality:

    • Current recombinant preparations achieve ~85% purity by SDS-PAGE

    • Potential for aggregation or misfolding affecting functional studies

    • Variability in tag systems used for purification may influence protein behavior

Biological Complexities:

  • Dual Functionality:

    • BCAP31's role in both protein transport and apoptosis regulation complicates target specificity

    • Differential functions in normal versus cancer cells require careful delineation

    • Potential compensatory mechanisms following BCAP31 inhibition remain poorly understood

  • Context-Dependent Effects:

    • Paradoxical findings in colorectal cancer (lower expression associated with worse outcomes)

    • Variable effects across different cancer types and stages

    • Need for comprehensive pan-cancer analysis of BCAP31 function

Translational Challenges:

  • Therapeutic Delivery:

    • As an ER membrane protein, BCAP31 presents challenges for targeted drug delivery

    • Need for innovative approaches to access intracellular targets

    • Development of appropriate model systems to test therapeutic efficacy

  • Biomarker Validation:

    • Standardization of BCAP31 detection methods for clinical application

    • Prospective validation in larger, diverse patient cohorts

    • Integration with existing prognostic and predictive biomarkers

Addressing these limitations will require collaborative efforts combining expertise in protein biochemistry, structural biology, cancer biology, and clinical translation to fully exploit BCAP31's potential as both a therapeutic target and prognostic biomarker.

How does BCAP31 research contribute to our broader understanding of cancer biology?

BCAP31 research provides valuable insights that extend beyond its specific functions to enhance our broader understanding of cancer biology:

  • Membrane Protein Trafficking in Cancer:

    • BCAP31's role in protein transport illuminates how altered trafficking pathways contribute to cancer progression

    • Demonstrates the importance of ER-Golgi communication in maintaining cellular homeostasis

    • Highlights how disruption of fundamental cellular processes can drive malignant phenotypes

  • EMT Regulation Mechanisms:

    • Reveals novel regulatory pathways controlling epithelial-mesenchymal transition

    • Demonstrates how proteins primarily known for transport functions can influence transcriptional programs

    • Provides a model for studying cross-talk between subcellular compartments in EMT regulation

  • Evolutionary Conservation in Cancer Pathways:

    • The study of BCAP31 across species (from human to Pongo abelii) demonstrates evolutionary conservation of cancer-relevant pathways

    • Suggests fundamental biological importance of these mechanisms

    • Supports the value of comparative oncology approaches

  • Integrative Multi-omics Approaches:

    • BCAP31 research exemplifies how integrating protein studies with transcriptomics and clinical data strengthens cancer biology research

    • Demonstrates the value of correlating molecular mechanisms with patient outcomes

    • Highlights the importance of validation across multiple experimental systems and patient cohorts

BCAP31 research thus contributes significantly to our understanding of the complex interplay between cellular transport mechanisms, transcriptional regulation, and cancer progression, while providing potential new avenues for therapeutic intervention and prognostic assessment.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.