Recombinant Pongo abelii Brain protein 44 (BRP44)

Shipped with Ice Packs
In Stock

Description

Introduction

Brain protein 44 (BRP44) is a highly conserved protein that has been identified across various species . Recent studies have renamed BRP44 as mitochondrial pyruvate carrier 2 (Mpc2) to reflect its function within the mitochondrial pyruvate carrier complex . This complex is essential for transporting pyruvate, a key product of glycolysis, into the mitochondria for the citric acid cycle . The discovery of BRP44's role in mitochondrial pyruvate transport has positioned it as a critical point in cellular metabolism and a potential target for therapeutic interventions .

Nomenclature and Discovery

Originally identified as a protein of unknown function, BRP44 was later found to be part of a complex responsible for mitochondrial pyruvate uptake . Independent research efforts led to the concurrent renaming of BRP44 and its related protein, BRP44-like (BRP44L), as Mpc2 and Mpc1, respectively . These proteins are now recognized as key components of the mitochondrial pyruvate carrier complex .

Function and Significance

BRP44, as part of the mitochondrial pyruvate carrier complex, plays a crucial role in cellular metabolism . The transport of pyruvate into the mitochondria is essential for the production of ATP via the citric acid cycle and oxidative phosphorylation.

3.1. Mitochondrial Pyruvate Carrier Complex

The mitochondrial pyruvate carrier complex, composed of Mpc1 and Mpc2 (formerly BRP44L and BRP44), facilitates the movement of pyruvate across the inner mitochondrial membrane . This transport is a critical step in energy production, linking glycolysis in the cytoplasm with the mitochondrial energy-generating pathways.

Research Findings

Several studies have highlighted the importance of BRP44/Mpc2 in various physiological processes.

4.1. Role in Insulin Sensitivity

Research indicates that BRP44 may be a target for insulin-sensitizing drugs . Studies suggest that these proteins form a multi-subunit complex that could provide a new target for designing insulin sensitizers .

4.2. Neuroprotection

Inhibition of the mitochondrial pyruvate carrier has been proposed as a neuroprotective strategy .

4.3. Heart Failure

Studies on human hearts with heart failure have examined the levels of MPC1 and MPC2, revealing the role of mitochondrial pyruvate carrier expression in cardiac function .

BRP44 and the Blood-Brain Barrier

The blood-brain barrier (BBB) is a highly selective barrier that protects the central nervous system by controlling the passage of substances into the brain . While there is no direct evidence, research on neurological disorders such as Alzheimer’s and Parkinson’s highlights the importance of understanding the BBB’s function and the potential for therapeutic interventions targeting this barrier .

Therapeutic Potential

Given its role in mitochondrial pyruvate transport, BRP44 represents a potential therapeutic target for metabolic disorders and neurodegenerative diseases.

6.1. Drug Development

Targeting BRP44 could lead to the development of new treatments for diseases characterized by impaired glucose metabolism or mitochondrial dysfunction.

6.2. Neuroprotective Strategies

Modulating BRP44 activity may offer a novel approach to neuroprotection by influencing neuronal energy metabolism and reducing oxidative stress .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
MPC2; BRP44; Mitochondrial pyruvate carrier 2; Brain protein 44
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-127
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
MPC2
Target Protein Sequence
MSAAGARGLRATYHRLLDKVELMLPEKLRPLYNHPAGPRTVFFWAPIMKRGLVCAGLADM ARPAEKLSTAQSAVLMATGFIWSRYSLVIIPKNWSLFAVNFFVGAAGASQLFRIWRYNQE LKAKAHK
Uniprot No.

Target Background

Function
Mediates pyruvate uptake into mitochondria.
Database Links
Protein Families
Mitochondrial pyruvate carrier (MPC) (TC 2.A.105) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

How does BRP44/MPC2 function in mitochondrial metabolism?

BRP44/MPC2 functions as part of a heterodimeric complex with MPC1 (previously known as BRP44L). This complex is essential for the transport of pyruvate across the inner mitochondrial membrane from the cytoplasm into the mitochondrial matrix. This transport step is critical as it connects cytosolic glycolysis with mitochondrial oxidative phosphorylation .

The MPC1/MPC2 complex facilitates pyruvate transport via a proton symport mechanism, where pyruvate movement is coupled with proton transport. This process is inhibited by compounds such as UK-5099 and certain thiazolidinediones. The function of this transport system is crucial for cellular energy metabolism, as pyruvate represents a key node in metabolic pathways including glucose oxidation, lipogenesis, and amino acid metabolism .

How conserved is BRP44/MPC2 across species and what does this suggest about its evolutionary importance?

BRP44/MPC2 is highly conserved from yeasts to humans, suggesting essential metabolic functions throughout evolution . Sequence analysis reveals significant homology between orangutan (Pongo abelii), human, mouse, and other mammals. For example, there is 100% sequence homology between mouse, rat, and human MPC2, indicating strong evolutionary conservation .

This high degree of conservation suggests that the protein's function in mitochondrial pyruvate transport represents a fundamental metabolic process that has been maintained throughout eukaryotic evolution. The conservation extends not just to the primary sequence but also to functional domains, particularly the transmembrane regions that are critical for its integration into the mitochondrial membrane and formation of the pyruvate transport channel .

What are the optimal conditions for expressing and purifying recombinant Pongo abelii BRP44/MPC2?

For successful expression and purification of recombinant Pongo abelii BRP44/MPC2:

Expression System:

  • E. coli is the preferred expression system due to its simplicity and high yield for this protein .

  • Express the full-length protein (1-127aa) with an N-terminal His tag for ease of purification.

Purification Protocol:

  • Lyse bacteria in Tris/PBS-based buffer (pH 8.0) with protease inhibitors

  • Purify using nickel affinity chromatography

  • Elute with imidazole buffer

  • Dialyze to remove imidazole

  • Add 6% trehalose as a stabilizer before lyophilization

Storage and Handling:

  • Store as a lyophilized powder at -20°C/-80°C

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 50% for long-term storage

  • Avoid repeated freeze-thaw cycles

  • Working aliquots can be stored at 4°C for up to one week

The purity should be greater than 90% as determined by SDS-PAGE analysis, which is crucial for experimental consistency and reliability.

What detection methods are most effective for studying BRP44/MPC2 in experimental systems?

Several detection methods are available for studying BRP44/MPC2, each with specific applications:

Western Blotting:

  • Recommended primary antibody: Mouse monoclonal antibody (like catalog number MABS1914)

  • Working dilution: 1-4 μg/mL for mouse and human MPC2 detection

  • Expected band size: ~14-15 kDa

  • Use mitochondrial enriched fractions to enhance detection sensitivity

  • α-Tubulin serves as an effective loading control for whole cell lysates

Immunoprecipitation:

  • Use 1:1,000 dilution of anti-MPC2 antibody

  • Most effective with mitoplasts from liver tissue

  • Can be used to study protein-protein interactions with MPC1 and other mitochondrial proteins

Subcellular Fractionation:

  • Separate cytoplasmic and mitochondrial fractions to confirm mitochondrial localization

  • Western blotting of fractions can reveal relative abundance in different cellular compartments

Flow Cytometry:

  • Not commonly used for MPC2 due to its mitochondrial localization

  • Mitochondrial function related to MPC2 can be assessed using MitoSOX for ROS detection

How can researchers effectively design knockdown or knockout experiments for BRP44/MPC2?

When designing knockdown or knockout experiments for BRP44/MPC2:

siRNA Knockdown Approach:

  • Design targeted siRNAs against conserved regions of the MPC2 gene

  • Transfect cells using appropriate methods (lipofection for adherent cells, nucleofection for neural progenitor cells)

  • Verify knockdown efficiency by qPCR and Western blotting

  • Assess effects on pyruvate transport using radiolabeled pyruvate uptake assays

CRISPR/Cas9 Knockout Strategy:

  • Design guide RNAs targeting early exons (preferably exon 1)

  • Screen for off-target effects using bioinformatic tools

  • Verify knockout by sequencing and protein expression analysis

  • Be aware that complete knockout may affect fertility or viability as observed with MPC1

Functional Validation:

  • Measure pyruvate-stimulated respiration using oxygen consumption assays

  • Assess cell cycle progression using PI pulse-chase

  • Analyze metabolic shifts using 13C-labeled glucose and mass spectrometry

  • Examine effects on stemness markers (ALDH, CD44, Nanog, Hif1α)

Important Considerations:

  • Include proper controls (scrambled siRNA, non-targeting guide RNA)

  • Consider compensation by MPC1 or other metabolic pathways

  • Monitor effects on cell viability and growth, as complete loss may be lethal

  • Use UK-5099 (a specific inhibitor of the MPC complex) as a pharmacological validation tool

How does BRP44/MPC2 function relate to cellular stemness and differentiation pathways?

Research has revealed a significant relationship between BRP44/MPC2 function and cellular stemness:

MPC Complex and Stemness Regulation:

  • MPC1 knockout cells show G0/G1 phase arrest and decreased proportion of cells in S and G2/M phases (p<0.001)

  • Loss of MPC function correlates with increased ALDH activity, a marker of stemness (p<0.001)

  • MPC-deficient cells demonstrate upregulation of stemness markers including CD44, Nanog, Hif1α, and Notch1

Metabolic Reprogramming:

  • MPC dysfunction forces cells to rely more on alternative metabolic pathways

  • This metabolic shift resembles the Warburg effect seen in cancer cells and stem cells

  • Reduced pyruvate entry into mitochondria may trigger changes in acetyl-CoA levels that affect histone acetylation and gene expression patterns related to stemness

Differentiation Impacts:

  • Proper MPC function appears necessary for normal cellular differentiation

  • Manipulating MPC activity may provide a metabolic approach to modulating stem cell fate

  • These findings suggest that MPC2 is not merely a metabolic transporter but plays a role in cellular identity regulation

This relationship between metabolism and stemness mediated by MPC proteins offers potential applications in regenerative medicine and cancer research.

What is the significance of BRP44/MPC2 as a target for thiazolidinedione (TZD) insulin sensitizers?

BRP44/MPC2 has emerged as a significant non-PPAR-γ target for thiazolidinedione (TZD) insulin sensitizers:

Molecular Targeting:

  • Mass spectrometry-based proteomics identified MPC1 and MPC2 as components of the mitochondrial target of TZDs (mTOT)

  • Photo-catalyzable drug analog probes directly crosslink to the MPC complex in mitochondrial membranes

  • Pre-incubation with UK5099 (a known MPC inhibitor) blocks this crosslinking, confirming specificity

Metabolic Effects:

  • PPARγ-sparing TZDs like MSDC-0602 alter the incorporation of 13C-labeled carbon from glucose into acetyl-CoA in brown adipose tissue cells

  • This suggests modulation of pyruvate flux into mitochondria as a mechanism of action

  • Knockdown of MPC proteins in Drosophila led to increased hemolymph glucose and blocked TZD drug action

Therapeutic Implications:

  • This discovery suggests a new mechanism for insulin-sensitizing drugs that may avoid the side effects associated with PPARγ activation

  • Understanding how TZDs modulate the MPC complex provides a pathway for developing more targeted metabolic therapeutics

  • The high conservation of MPC proteins across species supports the translational potential of these findings

This research indicates that BRP44/MPC2 represents an important metabolic control point with therapeutic potential beyond its basic transport function.

How do mutations or dysfunction of BRP44/MPC2 contribute to metabolic disorders and disease states?

Dysfunction of BRP44/MPC2 has significant implications for various disease states:

Metabolic Disorders:

  • Heterozygous MPC1 knockout mice demonstrate altered glucose and fatty acid metabolism

  • These mice show significantly higher body weight in females, suggesting sex-specific metabolic effects

  • Mitochondrial pyruvate carrier deficiency (MPCD) is recognized as an autosomal recessive condition that primarily involves the MPC1 gene, but may also involve MPC2 dysfunction

Neurological Implications:

  • MPC function is crucial for brain metabolism, where pyruvate serves as a critical energy substrate

  • Some research suggests that MPC deficiency paradoxically leads to neuronal hyperexcitability

  • This may be relevant to understanding epilepsy and other neurological disorders characterized by abnormal excitation

Cancer Biology:

  • MPC dysfunction is observed in many cancers and correlates with the Warburg effect

  • Loss of MPC function promotes stemness characteristics in cancer cells

  • MPC2 may represent a potential therapeutic target in cancer through modulation of metabolic plasticity

Cardiovascular Disorders:

  • Biventricular increases in mitochondrial fission mediator (MiD51) and MPC2 have been observed in pulmonary hypertension

  • This suggests MPC2's involvement in cardiac metabolism remodeling under pathological conditions

These findings highlight the importance of proper MPC function beyond simple metabolic regulation and point to potential therapeutic approaches targeting mitochondrial pyruvate transport.

What are common challenges in maintaining stability and activity of recombinant BRP44/MPC2?

Researchers frequently encounter several challenges when working with recombinant BRP44/MPC2:

Protein Stability Issues:

  • As a small membrane protein (127 amino acids), BRP44/MPC2 can be prone to aggregation

  • The lyophilized form is stable, but once reconstituted, degradation can occur

  • Addition of 6% trehalose to storage buffer helps maintain stability by preventing protein denaturation

  • Avoiding repeated freeze-thaw cycles is crucial for maintaining activity

Functional Assessment Challenges:

  • BRP44/MPC2 functions as part of a heterodimeric complex with MPC1

  • Recombinant BRP44/MPC2 alone may not exhibit transport activity without its partner protein

  • Consider co-expression with MPC1 for functional studies

  • Use inhibitor binding (e.g., UK-5099 or TZDs) as a proxy for structural integrity when direct transport assays aren't feasible

Expression and Purification Obstacles:

  • Optimal pH for stability is around 8.0; deviations can lead to precipitation

  • Despite His-tag presence, purification yield can be variable

  • Inclusion body formation is common when overexpressed in E. coli

  • Detergent selection is critical for extraction from membranes while maintaining native structure

Reconstitution Recommendations:

  • Reconstitute in deionized sterile water to 0.1-1.0 mg/mL

  • Add glycerol (final concentration 50%) for long-term storage

  • Store working aliquots at 4°C for maximum one week to maintain activity

  • For functional assays, consider reconstitution into liposomes to mimic membrane environment

How can researchers differentiate between effects of BRP44/MPC2 versus MPC1 in experimental systems?

Distinguishing the specific contributions of BRP44/MPC2 from those of MPC1 requires careful experimental design:

Selective Knockdown/Knockout Approaches:

  • Use gene-specific siRNAs or CRISPR targeting to selectively reduce either MPC1 or MPC2

  • MPC1 knockout shows weak MPC2 protein expression by immunocytochemistry, suggesting interdependence

  • Compare phenotypes between MPC1-specific, MPC2-specific, and double knockdowns

Expression Pattern Analysis:

  • Western blotting with specific antibodies can reveal different expression levels across tissues

  • MPC1 and MPC2 may have different tissue-specific expression patterns or regulation

  • Developmental timing of expression may also differ between the two proteins

Rescue Experiments:

  • Perform rescue experiments by re-expressing either MPC1 or MPC2 in double-knockdown cells

  • Assess whether the individual proteins can partially restore function

  • This can reveal functional redundancy or unique contributions of each protein

Interaction Studies:

  • Use co-immunoprecipitation to assess complex formation

  • BRP44/MPC2 stability often depends on MPC1 presence, while the reverse may not be true

  • Protein-protein interaction studies can reveal specific binding partners unique to each protein

Functional Readouts:

  • Monitor pyruvate transport, pyruvate-driven respiration, and metabolic flux

  • Compare effects of selective inhibitors that may have differential effects on the complex

  • Use 13C-labeled metabolic substrates to track metabolic flux alterations specific to each protein's dysfunction

What methodological approaches can overcome the challenges of studying mitochondrial membrane proteins like BRP44/MPC2?

Studying mitochondrial membrane proteins like BRP44/MPC2 presents unique challenges that can be addressed through specialized methodologies:

Isolation of Mitochondria and Submitochondrial Particles:

  • Differential centrifugation followed by density gradient purification yields intact mitochondria

  • Submitochondrial particle preparation exposes the inner membrane for direct access to MPC

  • For MPC2 immunoprecipitation, mitoplasts (mitochondria with outer membrane removed) provide better results

Membrane Protein Solubilization:

  • Mild detergents like digitonin preserve protein-protein interactions

  • DDM (n-dodecyl β-D-maltoside) is effective for solubilizing MPC complex while maintaining structure

  • Detergent concentration is critical: too high disrupts the complex, too low results in poor solubilization

Transport Assay Methodologies:

  • Radiolabeled pyruvate uptake assays using 14C-pyruvate

  • Indirect assessment using mitochondrial respiration measurements with pyruvate as substrate

  • Membrane potential-sensitive dyes to monitor changes associated with pyruvate/H+ co-transport

  • Monitor inhibition by UK-5099 as a control for MPC-specific transport

Advanced Imaging Techniques:

  • Fluorescently-tagged MPC proteins for dynamics and localization studies

  • Super-resolution microscopy to visualize submitochondrial localization

  • FRET-based approaches to assess protein-protein interactions in the native mitochondrial environment

Proteoliposome Reconstitution:

  • Purified proteins can be reconstituted into liposomes to study transport properties

  • This allows controlled manipulation of membrane composition and transport conditions

  • Different lipid compositions can be tested to optimize MPC function in artificial systems

  • Enables direct measurement of transport kinetics without interference from other mitochondrial processes

How does Pongo abelii BRP44/MPC2 compare structurally and functionally to human and other primate homologs?

A detailed comparison of BRP44/MPC2 across primate species reveals important similarities and differences:

Sequence Homology:

  • Pongo abelii BRP44/MPC2 shares extremely high sequence homology with human MPC2, reflecting their close evolutionary relationship

  • The 127-amino acid sequence is highly conserved across primates with few substitutions

  • Key functional domains, particularly the transmembrane segments, show nearly perfect conservation across primates

Structural Features:

  • All primate MPC2 proteins contain two predicted transmembrane α-helices

  • The N-terminal and C-terminal domains are exposed to the mitochondrial matrix

  • Comparative modeling suggests that the protein adopts a similar fold across primate species

  • Subtle species differences may exist in post-translational modification sites

Functional Conservation:

  • Pyruvate transport kinetics appear similar across primate species where studied

  • Inhibitor sensitivity (to compounds like UK-5099) is preserved, suggesting conservation of the binding pocket

  • Interaction with MPC1 to form the functional heterodimeric complex is maintained across species

Expression Patterns:

  • BRP44/MPC2 expression levels vary across tissues in similar patterns among primates

  • Brain, liver, and brown adipose tissue show relatively high expression levels in most species

  • Regulatory elements controlling expression show high conservation among closely related primates, suggesting similar transcriptional control mechanisms

This high degree of conservation across primates supports the use of non-human primate models for studying MPC function relevant to human health and disease.

What experimental design considerations are important when comparing BRP44/MPC2 function across different species models?

When comparing BRP44/MPC2 function across species, several critical experimental design factors must be considered:

Expression System Selection:

  • Use the same expression system (e.g., E. coli) when comparing proteins from different species

  • Consistent tags (e.g., N-terminal His tag) should be used across all proteins being compared

  • Post-translational modifications may vary in different expression systems, potentially affecting function

Assay Standardization:

  • Standardize functional assays to account for species-specific differences in optimal conditions

  • Use identical buffer compositions, pH, and temperature conditions where possible

  • Include internal controls (e.g., human MPC2) in each experiment to normalize cross-species comparisons

Interspecies Complex Formation:

  • Test whether MPC2 from one species can form functional complexes with MPC1 from another

  • This chimeric approach can reveal specific interaction domains and compatibility across species

  • Co-expression of species-matched MPC1 and MPC2 may be necessary for proper functional assessment

Metabolic Context:

Inhibitor Studies:

  • Compare inhibitor sensitivity profiles (UK-5099, TZDs) across species variants

  • Differences in IC50 values may reveal subtle structural variations in the binding pocket

  • These differences could inform species-specific drug development or explain variable drug responses across species

Statistical Approach:

  • Use multiple biological and technical replicates for robust statistical analysis

  • Consider evolutionary distance when grouping species for comparative analysis

  • Apply appropriate statistical corrections for multiple comparisons across species

These considerations ensure valid cross-species comparisons that can reveal both conserved functions and species-specific adaptations of BRP44/MPC2.

How can insights from evolutionary conservation of BRP44/MPC2 inform therapeutic approaches targeting mitochondrial metabolism?

The evolutionary conservation of BRP44/MPC2 provides valuable insights for therapeutic development:

Conserved Binding Pockets as Drug Targets:

  • The high conservation of MPC2 across species suggests functionally critical domains

  • TZDs (thiazolidinediones) target the MPC complex, indicating conserved drug-binding sites

  • Cross-species comparison of protein sequences can identify absolutely conserved residues that may be essential for function and thus promising drug targets

Validation of Model Systems:

  • The conservation allows valid extrapolation from model organisms to humans

  • Drosophila studies showed that MPC knockdown increased hemolymph glucose and blocked TZD action, supporting translational relevance

  • Mouse models with MPC manipulation show metabolic phenotypes that may predict human therapeutic responses

Metabolic Vulnerability Points:

  • Conserved metabolic checkpoints like the MPC represent potential "vulnerability nodes" in disease

  • Cancer cells often downregulate MPC function as part of metabolic reprogramming

  • Restoring or inhibiting MPC function may represent therapeutic strategies for metabolic diseases and cancer

Evolutionary Resistance Assessment:

  • Highly conserved proteins are less likely to develop resistance mutations

  • Analysis of natural variations across species can predict potential resistance mechanisms

  • This information can guide the design of combination therapies or drugs less prone to resistance development

Therapeutic Applications Table:

Disease ContextTherapeutic ApproachRationale Based on Evolutionary Conservation
Type 2 DiabetesMPC activatorsConserved role in insulin sensitivity across species suggests efficacy
CancerMPC inhibitors/activators (context-dependent)Altered metabolism is a hallmark of cancer; conservation suggests central role
Neurological DisordersMPC modulatorsConserved importance in brain energy metabolism across species
Stem Cell ApplicationsControlled MPC inhibitionConservation of MPC's role in stemness regulation suggests application in regenerative medicine

The deep evolutionary conservation of MPC function underscores its fundamental importance in cellular metabolism and highlights its potential as a therapeutic target across multiple disease contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.