Recombinant Pongo abelii Calcium-binding mitochondrial carrier protein Aralar1 (SLC25A12)

Shipped with Ice Packs
In Stock

Description

Functional Role

Transport Mechanism:

  • Facilitates calcium-dependent exchange of cytoplasmic glutamate for mitochondrial aspartate across the inner mitochondrial membrane .

  • Integral to the malate-aspartate shuttle (MAS), supporting NADH/NAD+ redox balance and ATP production .

Key Pathways:

  • Myelination: Required for oligodendrocyte maturation and myelin basic protein (MBP) synthesis .

  • Neuronal Metabolism: Sustains aspartate levels for N-acetyl aspartate (NAA) synthesis, critical for lipid myelination .

Research Applications

Disease Modeling:

  • AGC1 Deficiency: Homozygous SLC25A12 mutations cause early infantile epileptic encephalopathy (EIEE39), characterized by hypomyelination and seizures .

    • In vitro studies using SLC25A12-silenced OPCs show reduced MBP expression, reversible with pyruvate supplementation .

    • Knockout mice exhibit neurofilament accumulation, Purkinje cell defects, and 60% mortality by weaning .

Therapeutic Insights:

  • Overexpression enhances mitochondrial metabolism and insulin secretion in pancreatic cells .

  • Heterozygous models (50% AGC1 expression) mimic subclinical ASD-linked variants, revealing subtle myelination deficits .

Clinical and Pharmacological Relevance

Biomarker Potential:

  • Elevated SLC25A12 expression in autistic dorsolateral prefrontal cortex correlates with neuronal network alterations .

  • CSF NAA levels serve as a surrogate marker for AGC1 activity in hypomyelination disorders .

Drug Development:

  • Targeting calcium-binding domains could modulate MAS activity for metabolic disorders .

  • Recombinant protein used to generate polyclonal antibodies (e.g., Abbexa abx117621) for diagnostic assays .

Challenges and Future Directions

  • Expression Variability: Tagging (e.g., N-His) may alter calcium-binding kinetics; optimization required .

  • Therapeutic Strategies: Pyruvate supplementation rescues myelination defects in vitro, suggesting metabolic bypass routes .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will strive to fulfill your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of the protein is influenced by various factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that the tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
SLC25A12; ARALAR1; Calcium-binding mitochondrial carrier protein Aralar1; Mitochondrial aspartate glutamate carrier 1; Solute carrier family 25 member 12
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-678
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
SLC25A12
Target Protein Sequence
MAVKVQTTKRGDPHELRNIFLQYASTEVDGEHYMTPEDFVQRYLGLYNDPNSNPKIVQLL AGVADQTKDGLISYQEFLAFESVLCAPDSMFIVAFQLFDKSGNGEVTFENVKEIFGQTII HHHIPFNWDCEFIRLHFGHNRKKHLNYTEFTQFLQELQLEHARQAFALKDKSKSGVISGL DFSDIMVTIRSHMLTPFVEENLVSAAGGSISHQVSFSYFNAFNSLLNNMELVRKIYSTLA GTRKDVEVTKEEFAQSAIRYGQVTPLEIDILYQLADLYNASGRLTLADIERIAPLAEGAL PYNLAELQRQQSPGLGRPIWLQIAESAYRFTLGSVAGAVGATAVYPIDLVKTRMQNQRGS GSVVGELMYKNSFDCFKKVLRYEGFFGLYRGLIPQLIGVAPEKAIKLTVNDFVRDKFTRR DGSVPLPAEVLAGGCAGGSQVIFTNPLEIVKIRLQVAGEITTGPRVSALNVLRDLGIFGL YKGAKACFLRDIPFSAIYFPVYAHCKLLLADENGHVGGLNLLAAGAMAGVPAASLVTPAD VIKTRLQVAARAGQTTYSGVIDCFRKILREEGPSAFWKGTAARVFRSSPQFGVTLVTYEL LQRWFYIDFGGLKPAGSEPTPKSRIADLPPANPDHIGGYRLATATFAGIENKFGLYLPKF KSPSVAVVQPKAAVAATQ
Uniprot No.

Target Background

Function
Recombinant Pongo abelii Calcium-binding mitochondrial carrier protein Aralar1 (SLC25A12) is a mitochondrial and calcium-binding carrier that catalyzes the calcium-dependent exchange of cytoplasmic glutamate with mitochondrial aspartate across the mitochondrial inner membrane. This protein may play a role in the urea cycle.
Database Links
Protein Families
Mitochondrial carrier (TC 2.A.29) family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is the structural organization and functional role of Pongo abelii Aralar1 (SLC25A12)?

Aralar1 is a multi-pass membrane protein located in the inner mitochondrial membrane. The protein has a distinctive structure with:

  • N-terminal half containing 2 imperfect EF-hand domains and 3 canonical EF-hand calcium-binding domains

  • C-terminal half sharing 28-29% identity with other mitochondrial solute carrier family members

  • 6 putative transmembrane domains characteristic of mitochondrial carrier proteins

Functionally, Aralar1 serves as a calcium-dependent antiporter that facilitates the exchange of cytoplasmic glutamate with mitochondrial aspartate across the inner mitochondrial membrane. This transport mechanism is dependent on the binding of one calcium ion . As a key component of the malate-aspartate NADH shuttle system, Aralar1 plays a crucial role in supporting oxidative phosphorylation and ATP production .

The specific substrate selectivity of Aralar1 is confined primarily to L-aspartate, L-glutamate, and L-cysteine sulfinate, with little to no activity observed with other amino acids or metabolites .

How does calcium regulate the transport activity of Aralar1?

Calcium regulation of Aralar1 occurs through a unique mechanism:

  • Upon calcium binding to the EF-hand domains in the N-terminal region, the regulatory N-terminal domain binds to the C-terminal domain

  • This conformational change opens a vestibule that allows substrates to be translocated through the carrier domain

  • In the absence of calcium, the linker loop domain may close the vestibule, preventing substrates from entering the carrier domain

Importantly, the calcium-binding domains of Aralar1 are localized on the external side of the inner mitochondrial membrane. This means that Aralar1 activity is regulated by calcium through a mechanism independent of calcium entry into mitochondria. This represents a novel mechanism of calcium regulation of the aspartate/malate shuttle .

Experimental data shows that the aspartate/glutamate exchange reaction catalyzed by Aralar1 is stimulated by calcium on the external side of the inner mitochondrial membrane, providing direct evidence for this regulatory mechanism .

What analytical techniques are recommended for characterizing recombinant Aralar1?

For comprehensive characterization of recombinant Aralar1, multiple complementary techniques should be employed:

Protein Purification and Structural Analysis:

  • Sucrose gradient ultracentrifugation for enrichment of native membrane protein fractions

  • Blue-native PAGE followed by multidimensional gel electrophoresis for separation

  • In-gel digestion with multiple proteases (trypsin, chymotrypsin, and subtilisin) for complete sequence coverage

Mass Spectrometry Analysis:

  • Nano-ESI-LC-MS/MS using both collision-induced dissociation and electron transfer dissociation modes

  • Data handling with specialized software such as Modiro v1.1 along with Mascot v2.2

This multi-method approach has demonstrated exceptional results, achieving 99.85% combined sequence coverage of Aralar1 from multiple protease digestions . This level of characterization is critical for predicting protein conformation, identifying splice variants, discovering binding partners, and generating specific antibodies.

Detection and Quantification:

  • Western blotting with antibodies specific against defined peptide regions

  • ELISA-based methods for quantitative assessment in serum, plasma, and cell culture supernatants

What are the optimal methodologies for expression and purification of recombinant Pongo abelii Aralar1?

Expression System Optimization:
The most effective expression system for recombinant Aralar1 has been demonstrated to be E. coli with the following considerations:

  • Vector selection: pET-15b (for full-length protein) or pET-21b (for C-terminal domain) have proven successful

  • Induction conditions: Must be carefully optimized as the protein typically accumulates as inclusion bodies

  • Yield expectations: 40-60 mg/l of bacterial culture can be achieved under optimal conditions

Purification Protocol:

  • Harvest bacterial cells after induction

  • Isolate inclusion bodies by centrifugation

  • Perform multiple washing steps to increase purity

  • Confirm identity by N-terminal sequencing and reaction with specific antisera

Reconstitution Method:
For functional studies, purified recombinant Aralar1 must be reconstituted into liposomes:

  • Mix purified protein with phospholipids in the presence of detergent

  • Remove detergent by dialysis or absorption

  • Load liposomes with appropriate substrates for transport assays

Verification:

  • Western blot verification using antibodies specific against aralar1 peptide regions

  • Functional reconstitution into liposomes to verify transport activity

How can the aspartate/glutamate exchange activity of recombinant Aralar1 be accurately measured in vitro?

Several complementary approaches are available for measuring the transport activity of reconstituted Aralar1:

Substrate Uptake Assays:

  • Incorporate recombinant Aralar1 into liposomes containing 20 mM aspartate

  • Initiate transport by adding [14C]aspartate to external medium

  • Measure uptake using first-order kinetics (typical rate constants: 0.04-0.12 min-1)

  • Initial rates of 24.7-80.3 μmol/min/g of protein can be expected

Efflux Measurements:

  • Load proteoliposomes with [14C]aspartate

  • Monitor efflux in presence/absence of external substrates

  • Add potential inhibitors to confirm specificity

  • Expect extensive efflux upon addition of external aspartate or glutamate (10 mM)

  • Observe total inhibition by pyridoxal 5′-phosphate and bathophenanthroline

Substrate Specificity Analysis:
A comprehensive substrate panel should be tested to confirm specificity. Expect significant exchange only with:

  • L-aspartate

  • L-glutamate

  • L-cysteine sulfinate

As shown in this experimental data table:

Internal substrateSubstrate transport (μmol/min/g protein)
Citrin (similar to Aralar1)
[14C]Aspartate
None (Cl- present)1.4
L-Aspartate92.8
L-Glutamate55.3
L-Cysteinesulfinate81.2
L-Aminoadipate4.6
D-Aspartate8.1
D-Glutamate5.9

Electrogenicity Measurements:
To assess the electrogenic nature of transport:

  • Generate a K+ diffusion potential across proteoliposomal membranes with valinomycin/KCl

  • Measure rates of [14C]aspartateout/glutamatein and [14C]glutamateout/aspartatein exchanges

  • Observe stimulation and decrease in rates, respectively, confirming electrogenic transport

What is the relationship between SLC25A12 mutations and neurological disorders, and how can researchers investigate these connections?

SLC25A12 mutations have been implicated in several neurological disorders through multiple lines of evidence:

Autism Spectrum Disorders (ASDs):

  • Meta-analyses have identified statistically significant associations between ASD and variants in rs2292813 (OR = 1.190, 95% CI 1.052-1.346, P = 0.006) and rs2056202 (OR = 1.206, 95% CI 1.035-1.405, P = 0.016)

  • Family-based design studies show stronger associations compared to case-control designs

  • Further investigation revealed associations between specific SLC25A12 SNPs and restricted repetitive behavior (RRB) traits in ASD

Early Infantile Epileptic Encephalopathy 39 (EIEE39):

  • Homozygous mutations in SLC25A12 cause EIEE39, characterized by global hypomyelination of the central nervous system, refractory seizures, and neurodevelopmental impairment

Research Methodology for Investigating These Connections:

  • Genetic Association Studies:

    • Use family-based designs rather than case-control studies (demonstrated higher sensitivity)

    • Target SNPs rs2292813 and rs2056202 as priority candidates

    • Employ Transmission Disequilibrium Tests (TDT) and Family-Based Association Tests (FBAT)

  • Quantitative Trait Analysis:

    • Use standardized instruments like Repetitive Behavior Scale-Revised (RBS-R) for phenotyping

    • Conduct linear regression analyses for individual SNPs and haplotypes

    • Implement multiple testing corrections to ensure statistical validity

  • Animal Models:

    • Develop knockout or knockdown models of SLC25A12

    • Assess behavioral, neuroanatomical, and electrophysiological phenotypes

    • Investigate cellular mechanisms through in vitro studies

  • Rescue Studies:

    • Test potential therapeutic interventions, such as pyruvate supplementation, which has shown success in reversing myelin deficits in slice cultures from SLC25A12 knockout mice

What mechanisms link Aralar1 dysfunction to myelination defects, and how can researchers study this relationship?

The connection between Aralar1 dysfunction and myelination defects has been established through several experimental approaches:

Key Mechanisms:

  • Reduced aspartate/N-acetyl aspartate (NAA) production:

    • Loss of AGC1 activity leads to reduced production of aspartate and NAA

    • NAA is essential for myelin lipid synthesis and proper myelination

  • Altered NADH/NAD+ ratio:

    • Disruption of the malate-aspartate shuttle affects NADH/NAD+ ratio

    • This metabolic imbalance impacts oligodendrocyte function and myelination

  • Neuronal-oligodendrocyte interactions:

    • AGC1 activity in neurons affects their ability to support oligodendrocyte function

    • This disrupts the critical neuron-glia signaling necessary for proper myelination

Research Methodologies:

  • Animal Models:

    • SLC25A12-knockout mice show delayed development and die around 3 weeks after birth

    • P13-14 knockout brains exhibit reduction in myelin basic protein (MBP)-positive fibers

    • These models display abnormal neurofilamentous accumulations in neurons, suggesting defective axonal transport or neurodegeneration

  • Ex Vivo Studies:

    • Cerebellar slice cultures prepared from knockout mice demonstrate myelination defects

    • These deficits can be reversed by administration of pyruvate, providing insight into potential therapeutic approaches

  • In Vitro Studies:

    • Reduction of SLC25A12 in rat primary oligodendrocytes leads to cell-autonomous reduction in MBP expression

    • This confirms the direct role of AGC1 in oligodendrocyte maturation and myelination

  • Molecular Analysis:

    • qPCR analysis of myelin genes (Cldn11, Cnp1, Mag, Mobp, Olig2, Plp1, etc.)

    • Immunohistochemical analysis using antibodies against myelin components

    • Biochemical analyses of brain extracts using standard immunoblotting methods

What are the most effective approaches for developing and utilizing Aralar1 knockout/knockdown models?

Generation of Knockout Models:
Researchers have successfully developed SLC25A12-knockout mice by disrupting the Slc25a12 gene. These models have proven valuable for studying the physiological role of Aralar1:

  • Verification of Knockout:

    • Confirm absence of AGC1 by immunoblotting on brain extracts

    • Use standard alkaline phosphatase or HRP-conjugated secondary antibodies for detection

  • Developmental Assessments:

    • Monitor developmental milestones (knockout mice display delayed development)

    • Track survival (knockout mice typically die around 3 weeks after birth)

    • Perform brain imaging analysis to assess gross structural changes

Alternative Knockdown Approaches:
For cell-specific or conditional knockdown:

  • Oligodendrocyte-Specific Knockdown:

    • Prepare oligodendrocyte precursor cells (OPCs) from rat brain

    • Nucleofect using specialized kits (e.g., rat oligodendrocyte kit VPG-1009, Amaxa)

    • Plate nucleofected OPCs in proliferation medium for 2 days, then switch to differentiation medium

    • Fix with 4% paraformaldehyde and immunostain with appropriate antibodies

    • Analyze by confocal microscopy in a blinded manner

  • Ex Vivo Models:

    • Prepare cerebellar slice cultures from P10 littermates

    • Maintain cultures for 7 days in vitro

    • Fix with 4% paraformaldehyde and process for immunohistochemistry

    • Analyze by fluorescence microscopy

Rescue Experiments:
To confirm specificity and explore therapeutic avenues:

  • Administer pyruvate to slice cultures from knockout mice

  • Observe reversal of myelin deficits, confirming the metabolic basis of the phenotype

  • This approach provides insights into potential therapeutic interventions for SLC25A12-related disorders

What are the methodological challenges in studying calcium-dependent regulation of Aralar1, and how can researchers address them?

Key Challenges:

  • Maintaining Native Protein Conformation:

    • Preserving the calcium-binding properties of Aralar1 during purification and reconstitution is technically challenging

    • The EF-hand domains in the N-terminal region are particularly susceptible to denaturation

  • Membrane Protein Reconstitution:

    • As an integral membrane protein, Aralar1 requires careful reconstitution into liposomes to maintain functionality

    • Orientation of the protein within the membrane is critical, as calcium-binding domains must be accessible to external calcium

  • Physiological Calcium Concentrations:

    • Maintaining physiologically relevant calcium concentrations during in vitro assays is difficult

    • The protein binds calcium with high affinity, requiring precise control of calcium levels

  • Electrogenicity of Transport:

    • The electrogenic nature of aspartate/glutamate exchange complicates transport measurements

    • Membrane potential influences must be carefully controlled and accounted for

Methodological Solutions:

  • Experimental Design for Calcium Regulation Studies:

    • Use proteoliposomes with defined orientation to ensure calcium-binding domains are accessible

    • Employ calcium buffers to maintain precise calcium concentrations

    • Include calcium chelators (e.g., EGTA) as negative controls

  • Measuring Calcium-Dependent Conformational Changes:

    • Express the N-terminal half containing the calcium-binding domains separately

    • Confirm calcium binding through in vitro binding assays

    • Verify that calcium binding requires the presence of the two most distal EF-hands

  • Tracking Membrane Protein Orientation:

    • Use domain-specific antibodies to confirm correct orientation in reconstituted systems

    • Employ protease protection assays to determine topology of reconstituted protein

  • Controlling Membrane Potential:

    • Generate K+ diffusion potential across proteoliposomal membranes with valinomycin/KCl

    • Measure transport rates under varying membrane potential conditions

    • Verify electrogenic nature of transport by observing differential effects on heterologous exchanges

How does Aralar1 functionally integrate with other components of mitochondrial metabolism?

Aralar1 plays a central role in coordinating several key mitochondrial pathways:

Malate-Aspartate NADH Shuttle:

  • Aralar1 functions as an essential component of the malate-aspartate shuttle

  • This system transfers reducing equivalents from cytosolic NADH into the mitochondrial matrix

  • The shuttle is crucial for maintaining optimal NADH/NAD+ ratios in both compartments

  • Disruption of Aralar1 impairs shuttle function, leading to metabolic derangements

Calcium Signaling Integration:

  • Aralar1 represents a novel mechanism for calcium regulation of mitochondrial metabolism

  • The calcium-binding domains on the external face of the inner mitochondrial membrane allow direct sensing of cytosolic calcium changes

  • This provides a mechanism for calcium to regulate mitochondrial metabolism independent of calcium entry into mitochondria

ATP Production:

  • By supporting the malate-aspartate shuttle, Aralar1 facilitates oxidative phosphorylation

  • This is particularly important in tissues with high energy demands, such as brain and muscle

  • Disruption of Aralar1 function can lead to reduced ATP production and energy deficits

Neuron-Glia Metabolic Coupling:

  • In neural tissues, Aralar1 contributes to metabolic cooperation between neurons and glia

  • It supports the transfer of metabolites between cell types necessary for proper brain function

  • This is evidenced by the hypomyelination observed in Aralar1-deficient models

Experimental Approaches to Study Integration:

  • Overexpression Studies:

    • Transfect human cells with Aralar1-expressing constructs

    • Measure resulting increases in malate/aspartate NADH shuttle activity

    • This approach has successfully demonstrated the direct role of Aralar1 in shuttle function

  • Metabolic Flux Analysis:

    • Use isotope-labeled substrates to track metabolite movement between compartments

    • Measure impact of Aralar1 manipulation on flux through various metabolic pathways

    • Quantify changes in NADH/NAD+ ratios in different cellular compartments

  • Mitochondrial Function Assessment:

    • Measure oxygen consumption rates using respirometry

    • Assess membrane potential with fluorescent probes

    • Determine ATP production rates under various conditions

    • Compare results between wild-type and Aralar1-deficient systems

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.