Recombinant Pongo abelii Cell cycle control protein 50A (TMEM30A)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Pongo abelii Cell Cycle Control Protein 50A (TMEM30A)

Recombinant Pongo abelii Cell Cycle Control Protein 50A (TMEM30A) is a full-length transmembrane protein expressed in heterologous systems (e.g., E. coli or Wheat germ) for research applications . It belongs to the CDC50 family and serves as the β-subunit of P4-ATPase flippase complexes, which maintain phospholipid asymmetry in membranes by translocating aminophospholipids (e.g., phosphatidylserine) from the outer to inner leaflet .

Amino Acid Composition

The recombinant protein includes conserved domains critical for P4-ATPase interaction and phospholipid translocation. A partial sequence from Pongo abelii TMEM30A includes motifs such as:
AMNYNAKDEVDGGPPCAPGGSAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIF... .

Role in Biological Processes

  • Phospholipid Asymmetry: Maintains membrane phospholipid distribution, essential for vesicle formation and cell signaling .

  • Cell Fusion: Required for myoblast fusion via actin remodeling and RAC1 GTPase targeting .

  • Immune Regulation: Loss-of-function mutations in TMEM30A enhance phosphatidylserine exposure, modulating NK cell cytotoxicity and tumor evasion .

Experimental Models

Study FocusKey FindingsSource
LymphomagenesisTMEM30A loss-of-function mutations increase B-cell receptor signaling and drug accumulation, correlating with favorable outcomes in diffuse large B-cell lymphoma (DLBCL) .
HematopoiesisConditional deletion in hematopoietic cells causes embryonic lethality due to anemia, impaired erythropoiesis, and defective lipid raft formation .
Podocyte InjuryTMEM30A deficiency in podocytes exacerbates pyroptosis and FSGS progression, linked to NLRP3 inflammasome activation .

Mechanistic Studies

  • Drug Uptake: TMEM30A mediates the internalization of anti-tumor phospholipids (e.g., edelfosine) and platelet-activating factor (PAF) .

  • Vesicle Transport: Required for clathrin-mediated vesicle budding in insulin secretion and glucose transporter 2 (Glut2) trafficking .

Disease Associations

DiseaseTMEM30A InvolvementSource
LymphomaLoss-of-function mutations linked to improved chemotherapy efficacy and CD47 blockade sensitivity .
Diabetesβ-cell-specific deletion causes hyperglycemia, insulin resistance, and impaired glucose-stimulated insulin secretion .
FSGSDownregulated in podocytes, exacerbating pyroptosis and nephrotic syndrome .

Therapeutic Targets

  • Immunochemotherapy: TMEM30A-deficient tumors show heightened susceptibility to NK cell-mediated phagocytosis when combined with anti-CD47 therapy .

  • Metabolic Disorders: Modulating TMEM30A activity may restore insulin maturation and glucose homeostasis in diabetes .

Challenges and Future Directions

  • Species-Specific Variations: Functional studies on Pongo abelii TMEM30A remain limited compared to human and murine models.

  • Structural Elucidation: High-resolution crystallography of the TMEM30A:P4-ATPase complex is needed to clarify substrate specificity and regulatory mechanisms.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If a specific tag type is required, please inform us for preferential development.
Synonyms
TMEM30A; CDC50A; Cell cycle control protein 50A; P4-ATPase flippase complex beta subunit TMEM30A; Transmembrane protein 30A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-361
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
AMNYNAKDEVDGGPPCAPGGSAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIF IPIGIGIFVTSNNIREIEIDYTGTEPSSPCNKCLSPDVTPCICTINFTLEKSFEGNVFMY YGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKECEPYRRNEDKPIAPCGAIANSMFND TLELFLIGNDSYPIPIALKKKGIAWWTDKNVKFRNPPGGDNLKERFKGTTKPVNWLKPVY MLDSDPDNNGFINEDFIVWMRTAALPTFRKLYRLIERKSDLHPTLPAGRYSLNVTYNYPV HYFDGRKRMILSTISWMGGKNPFLGIAYIAVGSISFLLGVVLLVINHKYRNSSNTADITI
Uniprot No.

Target Background

Function

TMEM30A is an accessory component of the P4-ATPase flippase complex. This complex catalyzes ATP-dependent aminophospholipid transport from the outer to the inner leaflet of various membranes, maintaining asymmetric phospholipid distribution. This translocation is implicated in vesicle formation and the uptake of lipid signaling molecules. The beta subunit (TMEM30A) may facilitate phospholipid substrate binding. TMEM30A is essential for proper folding, assembly, and ER-to-Golgi transport of the ATP8A2:TMEM30A flippase complex. The ATP8A2:TMEM30A complex may regulate neurite outgrowth and, when reconstituted into liposomes, primarily transports phosphatidylserine (PS) and, to a lesser extent, phosphatidylethanolamine (PE). The ATP8A1:TMEM30A complex appears to regulate cell migration, potentially through flippase-mediated phosphatidylethanolamine (PE) translocation at the plasma membrane. TMEM30A is required for the formation of intermediate phosphoenzymes in ATP8A2, ATP8B1, and ATP8B2 P-type ATPases. It is involved in platelet-activating factor (PAF) uptake and may mediate the export of alpha subunits (ATP8A1, ATP8B1, ATP8B2, ATP8B4, ATP10A, ATP10B, ATP10D, ATP11A, ATP11B, and ATP11C) from the ER to other membrane locations.

Database Links
Protein Families
CDC50/LEM3 family
Subcellular Location
Membrane; Multi-pass membrane protein. Golgi apparatus. Cytoplasmic vesicle, secretory vesicle membrane. Apical cell membrane. Photoreceptor inner segment. Cell projection, cilium, photoreceptor outer segment.

Q&A

What are the recommended storage and handling conditions for recombinant TMEM30A protein?

For optimal stability and activity of recombinant Pongo abelii TMEM30A:

  • Store at -20°C for routine storage; for extended storage, maintain at -20°C or -80°C

  • Avoid repeated freeze-thaw cycles which significantly reduce protein activity

  • Store working aliquots at 4°C for up to one week

  • The protein is optimally maintained in Tris-based buffer with 50% glycerol

When reconstituting lyophilized protein, researchers should:

  • Briefly centrifuge the vial prior to opening

  • Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% for long-term storage

What experimental approaches can be used to study TMEM30A's role in phospholipid flipping?

To effectively study TMEM30A's flippase activity:

In vitro flippase activity assay:

  • Co-express TMEM30A with ATP8A2 in HEK293T cells

  • Use fluorescently labeled phosphatidylserine analogs to track flipping activity

  • Measure the internalization rate of labeled phospholipids using flow cytometry

Data from experimental studies show that truncated TMEM30A mutants (R226X, R290X, R307X) fail to form a complex with ATP8A2, while missense TMEM30A mutants (C94R, D181Y) demonstrate reduced flippase activity despite complex formation . These findings demonstrate the importance of both complex formation and proper glycosylation for flippase function.

How can researchers effectively manipulate TMEM30A expression in experimental systems?

Several validated approaches for TMEM30A manipulation include:

Overexpression systems:

  • Transfection of plasmids containing TMEM30A in cancer cell lines (such as SMMC-7721 and HeLa cells)

  • Verification through mRNA expression levels using qPCR and protein expression by Western blot

  • Functional validation by measuring the internalization of fluorescent phospholipids

Gene silencing approaches:

  • Short hairpin RNA (shRNA) knockdown of TMEM30A (validated in multiple studies)

  • CRISPR-Cas9 gene editing for complete knockout

  • Conditional knockout using Cre-LoxP system in mouse models (as demonstrated in pancreatic β-cell specific knockout studies)

Experimental data shows that shRNA knockdown of TMEM30A significantly reduces the uptake of fluorescent choline phospholipids and [(3)H]PAF, confirming its role in phospholipid transport .

How does TMEM30A contribute to cell migration in tumor progression?

TMEM30A plays a critical role in tumor cell migration through several interconnected mechanisms:

  • Membrane ruffle formation: TMEM30A, in complex with P4-ATPases, facilitates the formation of membrane ruffles through phospholipid translocation, which is essential for directional migration

  • Signaling network regulation: Studies combining computational predictions and experimental validation have identified a migration-related signaling network regulated by TMEM30A, which includes:

    • Cytoskeletal proteins (ACTB, WASL, CDC42)

    • Transmembrane proteins (CLTC, RHO)

    • Kinases (SRC)

    • Transcription factors (SUB1)

  • Gene expression modulation: Overexpression of TMEM30A with ATP11A significantly increases the migration rate of cancer cells (7721 and HeLa), with statistical analysis showing migration rates increased starting from 12-24 hours post-transfection

Quantitative PCR validation demonstrated that TMEM30A regulates the expression of migration-related genes including SUB1, SLC2A1, CTNNB1, ACTB, and CLTC .

What is the relationship between TMEM30A and phospholipid asymmetry in apoptosis and cell survival?

TMEM30A maintains plasma membrane phospholipid asymmetry, which has profound implications for cell survival:

  • Prevention of apoptotic signaling:

    • TMEM30A, as the β-subunit of flippases, maintains phosphatidylserine (PS) on the inner leaflet of the plasma membrane

    • When deficient, PS exposure on the outer leaflet serves as an "eat-me" signal for macrophages

    • This mechanism is particularly relevant in lymphoma, where TMEM30A mutations contribute to disease progression

  • Sensitivity to apoptotic agents:

    • TMEM30A knockdown reduces sensitivity to apoptosis induced by Edelfosine and oxidatively truncated phospholipid azelaoyl phosphatidylcholine

    • The mechanism involves impaired mitochondrial depolarization in response to these agents

Experimental data suggests that the phospholipid import system facilitated by TMEM30A is essential for the cytotoxic effects of certain antitumor agents, presenting potential therapeutic implications .

How do TMEM30A mutations affect B-cell lymphoma progression and therapy response?

TMEM30A mutations in B-cell lymphoma show distinct patterns with significant clinical implications:

  • Mutation characteristics:

    • Recurrent biallelic inactivation of TMEM30A occurs in diffuse large B-cell lymphoma (DLBCL)

    • Truncated mutants (R226X, R290X, R307X) fail to associate with ATP8A2

    • Missense mutants (C94R, D181Y) show reduced glycosylation and decreased flippase activity

  • Prognostic implications:

    • TMEM30A mutations are significantly associated with favorable outcomes

    • Patients with biallelic alterations show significantly longer time to progression compared to those with wild-type TMEM30A (P = 0.035; log-rank test)

    • The prognostic effect is particularly evident in patients with high International Prognostic Index (IPI) scores

This data suggests that TMEM30A mutations, particularly biallelic alterations, represent a genetic subtype with distinct clinical behavior that could inform therapeutic decisions.

What role does TMEM30A play in podocyte injury and focal segmental glomerulosclerosis (FSGS)?

Recent research has identified TMEM30A as a critical regulator of podocyte function:

  • Metabolic dysregulation:

    • Transcriptomic and metabolomic analysis of TMEM30A-knockdown mouse podocytes revealed reduced expression of glycolysis-related genes

    • Expression of glycolytic proteins (ALDOA, HK2, LDHA, and GAPDH) was reduced in podocyte-specific TMEM30A knockout mice and in FSGS patients

  • Rescue experiments:

    • Restored expression of TMEM30A (resTmem30a) partially reversed the downregulation of:

      • Podocyte markers (WT1, Synaptopodin)

      • Glycolysis-related molecules (ALDOA, HK2, LDHA, GAPDH)

    • This suggests TMEM30A mediates podocyte injury through glycolytic regulation

These findings identify TMEM30A as a potential therapeutic target for FSGS, with glycolysis modulation representing a mechanistic pathway for intervention.

How can researchers effectively distinguish between the functions of TMEM30A and other TMEM30 family members?

Differentiating between TMEM30 family members requires specialized approaches:

  • Expression pattern analysis:

    • TMEM30A and TMEM30B are widely expressed throughout the body

    • TMEM30C expression is restricted to the testes and brain

    • TMEM30A is the most abundantly expressed and interacts with 11 of 14 P4-ATPases

  • Selective knockout strategies:

    • Tissue-specific knockout models using Cre-loxP systems (e.g., pancreatic β cell-specific, podocyte-specific)

    • Complementation experiments with different TMEM30 family members to test functional redundancy

  • Interaction partner analysis:

    • TMEM30A interacts with multiple P4-ATPases: ATP8B1, ATP8B2, ATP8B4, ATP8A2, ATP8A1

    • Co-immunoprecipitation with specific P4-ATPases can help distinguish the functions of different TMEM30 family members

These approaches allow researchers to determine the specific roles of TMEM30A in different tissues and cellular processes.

What are the challenges in interpreting apparently contradictory roles of TMEM30A in different cancer types?

Research indicates complex, context-dependent roles of TMEM30A in cancer:

  • Paradoxical observations:

    • Overexpression of TMEM30A promotes tumor cell migration in certain contexts

    • TMEM30A mutations are associated with favorable outcomes in B-cell lymphoma

    • TMEM30A is required for uptake of antitumor alkylphospholipids

  • Methodological approaches to resolve contradictions:

    • Cell type-specific analysis of TMEM30A function

    • Comprehensive characterization of TMEM30A interactome in different cancer types

    • Integration of genomic, transcriptomic, and proteomic data

    • Analysis of TMEM30A's dual roles in both promoting cell survival and enabling apoptotic agent uptake

Understanding these seemingly contradictory functions requires careful consideration of tissue context, interacting partners, and specific cellular processes being studied.

What are the key considerations when using recombinant Pongo abelii TMEM30A as a model for human TMEM30A studies?

When using Pongo abelii TMEM30A as a model:

  • Sequence conservation analysis:

    • Perform comparative sequence analysis between human and Pongo abelii TMEM30A

    • Focus on conserved functional domains and post-translational modification sites

    • The high conservation (Uniprot No.: Q5R6C0 for Pongo abelii variant) suggests functional similarity

  • Functional validation:

    • Compare flippase activity using standardized assays

    • Validate interaction with human P4-ATPases through co-immunoprecipitation studies

    • Test complementation of TMEM30A-deficient human cells with Pongo abelii TMEM30A

  • Expression system considerations:

    • Recombinant proteins may have tag-dependent effects on function

    • The tag type should be carefully selected during the production process

    • Expression in mammalian systems may provide more physiologically relevant post-translational modifications than E. coli-expressed protein

What advanced imaging techniques are most effective for studying TMEM30A localization and dynamics?

Cutting-edge imaging approaches for TMEM30A research include:

  • High-resolution localization studies:

    • Super-resolution microscopy (STORM, PALM) to visualize TMEM30A beyond the diffraction limit

    • Confocal microscopy with TMEM30A-GFP chimeras has successfully demonstrated localization to plasma membranes and internal organelles

  • Dynamic tracking methods:

    • Fluorescence recovery after photobleaching (FRAP) to study mobility in membranes

    • Single-particle tracking to follow individual TMEM30A molecules

    • Bimolecular fluorescence complementation (BiFC) to visualize protein-protein interactions

  • Functional imaging:

    • Live-cell imaging with fluorescent phospholipid analogs to track flipping activity

    • Membrane raft visualization using specialized lipid probes

    • Confocal microscopy analysis has revealed that TMEM30A deficiency impairs the localization of erythropoietin receptor to membrane raft microdomains in erythroid progenitors

These advanced imaging techniques provide crucial insights into the dynamic behavior and functional interactions of TMEM30A in living cells.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.