Recombinant Pongo abelii Cell Cycle Control Protein 50A (TMEM30A) is a full-length transmembrane protein expressed in heterologous systems (e.g., E. coli or Wheat germ) for research applications . It belongs to the CDC50 family and serves as the β-subunit of P4-ATPase flippase complexes, which maintain phospholipid asymmetry in membranes by translocating aminophospholipids (e.g., phosphatidylserine) from the outer to inner leaflet .
The recombinant protein includes conserved domains critical for P4-ATPase interaction and phospholipid translocation. A partial sequence from Pongo abelii TMEM30A includes motifs such as:
AMNYNAKDEVDGGPPCAPGGSAKTRRPDNTAFKQQRLPAWQPILTAGTVLPIFFIIGLIF... .
Phospholipid Asymmetry: Maintains membrane phospholipid distribution, essential for vesicle formation and cell signaling .
Cell Fusion: Required for myoblast fusion via actin remodeling and RAC1 GTPase targeting .
Immune Regulation: Loss-of-function mutations in TMEM30A enhance phosphatidylserine exposure, modulating NK cell cytotoxicity and tumor evasion .
Drug Uptake: TMEM30A mediates the internalization of anti-tumor phospholipids (e.g., edelfosine) and platelet-activating factor (PAF) .
Vesicle Transport: Required for clathrin-mediated vesicle budding in insulin secretion and glucose transporter 2 (Glut2) trafficking .
Immunochemotherapy: TMEM30A-deficient tumors show heightened susceptibility to NK cell-mediated phagocytosis when combined with anti-CD47 therapy .
Metabolic Disorders: Modulating TMEM30A activity may restore insulin maturation and glucose homeostasis in diabetes .
Species-Specific Variations: Functional studies on Pongo abelii TMEM30A remain limited compared to human and murine models.
Structural Elucidation: High-resolution crystallography of the TMEM30A:P4-ATPase complex is needed to clarify substrate specificity and regulatory mechanisms.
TMEM30A is an accessory component of the P4-ATPase flippase complex. This complex catalyzes ATP-dependent aminophospholipid transport from the outer to the inner leaflet of various membranes, maintaining asymmetric phospholipid distribution. This translocation is implicated in vesicle formation and the uptake of lipid signaling molecules. The beta subunit (TMEM30A) may facilitate phospholipid substrate binding. TMEM30A is essential for proper folding, assembly, and ER-to-Golgi transport of the ATP8A2:TMEM30A flippase complex. The ATP8A2:TMEM30A complex may regulate neurite outgrowth and, when reconstituted into liposomes, primarily transports phosphatidylserine (PS) and, to a lesser extent, phosphatidylethanolamine (PE). The ATP8A1:TMEM30A complex appears to regulate cell migration, potentially through flippase-mediated phosphatidylethanolamine (PE) translocation at the plasma membrane. TMEM30A is required for the formation of intermediate phosphoenzymes in ATP8A2, ATP8B1, and ATP8B2 P-type ATPases. It is involved in platelet-activating factor (PAF) uptake and may mediate the export of alpha subunits (ATP8A1, ATP8B1, ATP8B2, ATP8B4, ATP10A, ATP10B, ATP10D, ATP11A, ATP11B, and ATP11C) from the ER to other membrane locations.
STRING: 9601.ENSPPYP00000018784
For optimal stability and activity of recombinant Pongo abelii TMEM30A:
Store at -20°C for routine storage; for extended storage, maintain at -20°C or -80°C
Avoid repeated freeze-thaw cycles which significantly reduce protein activity
Store working aliquots at 4°C for up to one week
The protein is optimally maintained in Tris-based buffer with 50% glycerol
When reconstituting lyophilized protein, researchers should:
Briefly centrifuge the vial prior to opening
Reconstitute in deionized sterile water to a concentration of 0.1-1.0 mg/mL
Add glycerol to a final concentration of 5-50% for long-term storage
To effectively study TMEM30A's flippase activity:
In vitro flippase activity assay:
Co-express TMEM30A with ATP8A2 in HEK293T cells
Use fluorescently labeled phosphatidylserine analogs to track flipping activity
Measure the internalization rate of labeled phospholipids using flow cytometry
Data from experimental studies show that truncated TMEM30A mutants (R226X, R290X, R307X) fail to form a complex with ATP8A2, while missense TMEM30A mutants (C94R, D181Y) demonstrate reduced flippase activity despite complex formation . These findings demonstrate the importance of both complex formation and proper glycosylation for flippase function.
Several validated approaches for TMEM30A manipulation include:
Overexpression systems:
Transfection of plasmids containing TMEM30A in cancer cell lines (such as SMMC-7721 and HeLa cells)
Verification through mRNA expression levels using qPCR and protein expression by Western blot
Functional validation by measuring the internalization of fluorescent phospholipids
Gene silencing approaches:
Short hairpin RNA (shRNA) knockdown of TMEM30A (validated in multiple studies)
CRISPR-Cas9 gene editing for complete knockout
Conditional knockout using Cre-LoxP system in mouse models (as demonstrated in pancreatic β-cell specific knockout studies)
Experimental data shows that shRNA knockdown of TMEM30A significantly reduces the uptake of fluorescent choline phospholipids and [(3)H]PAF, confirming its role in phospholipid transport .
TMEM30A plays a critical role in tumor cell migration through several interconnected mechanisms:
Membrane ruffle formation: TMEM30A, in complex with P4-ATPases, facilitates the formation of membrane ruffles through phospholipid translocation, which is essential for directional migration
Signaling network regulation: Studies combining computational predictions and experimental validation have identified a migration-related signaling network regulated by TMEM30A, which includes:
Gene expression modulation: Overexpression of TMEM30A with ATP11A significantly increases the migration rate of cancer cells (7721 and HeLa), with statistical analysis showing migration rates increased starting from 12-24 hours post-transfection
Quantitative PCR validation demonstrated that TMEM30A regulates the expression of migration-related genes including SUB1, SLC2A1, CTNNB1, ACTB, and CLTC .
TMEM30A maintains plasma membrane phospholipid asymmetry, which has profound implications for cell survival:
Prevention of apoptotic signaling:
TMEM30A, as the β-subunit of flippases, maintains phosphatidylserine (PS) on the inner leaflet of the plasma membrane
When deficient, PS exposure on the outer leaflet serves as an "eat-me" signal for macrophages
This mechanism is particularly relevant in lymphoma, where TMEM30A mutations contribute to disease progression
Sensitivity to apoptotic agents:
Experimental data suggests that the phospholipid import system facilitated by TMEM30A is essential for the cytotoxic effects of certain antitumor agents, presenting potential therapeutic implications .
TMEM30A mutations in B-cell lymphoma show distinct patterns with significant clinical implications:
Mutation characteristics:
Prognostic implications:
TMEM30A mutations are significantly associated with favorable outcomes
Patients with biallelic alterations show significantly longer time to progression compared to those with wild-type TMEM30A (P = 0.035; log-rank test)
The prognostic effect is particularly evident in patients with high International Prognostic Index (IPI) scores
This data suggests that TMEM30A mutations, particularly biallelic alterations, represent a genetic subtype with distinct clinical behavior that could inform therapeutic decisions.
Recent research has identified TMEM30A as a critical regulator of podocyte function:
Metabolic dysregulation:
Rescue experiments:
These findings identify TMEM30A as a potential therapeutic target for FSGS, with glycolysis modulation representing a mechanistic pathway for intervention.
Differentiating between TMEM30 family members requires specialized approaches:
Expression pattern analysis:
Selective knockout strategies:
Tissue-specific knockout models using Cre-loxP systems (e.g., pancreatic β cell-specific, podocyte-specific)
Complementation experiments with different TMEM30 family members to test functional redundancy
Interaction partner analysis:
These approaches allow researchers to determine the specific roles of TMEM30A in different tissues and cellular processes.
Research indicates complex, context-dependent roles of TMEM30A in cancer:
Paradoxical observations:
Methodological approaches to resolve contradictions:
Cell type-specific analysis of TMEM30A function
Comprehensive characterization of TMEM30A interactome in different cancer types
Integration of genomic, transcriptomic, and proteomic data
Analysis of TMEM30A's dual roles in both promoting cell survival and enabling apoptotic agent uptake
Understanding these seemingly contradictory functions requires careful consideration of tissue context, interacting partners, and specific cellular processes being studied.
When using Pongo abelii TMEM30A as a model:
Sequence conservation analysis:
Functional validation:
Compare flippase activity using standardized assays
Validate interaction with human P4-ATPases through co-immunoprecipitation studies
Test complementation of TMEM30A-deficient human cells with Pongo abelii TMEM30A
Expression system considerations:
Cutting-edge imaging approaches for TMEM30A research include:
High-resolution localization studies:
Dynamic tracking methods:
Fluorescence recovery after photobleaching (FRAP) to study mobility in membranes
Single-particle tracking to follow individual TMEM30A molecules
Bimolecular fluorescence complementation (BiFC) to visualize protein-protein interactions
Functional imaging:
Live-cell imaging with fluorescent phospholipid analogs to track flipping activity
Membrane raft visualization using specialized lipid probes
Confocal microscopy analysis has revealed that TMEM30A deficiency impairs the localization of erythropoietin receptor to membrane raft microdomains in erythroid progenitors
These advanced imaging techniques provide crucial insights into the dynamic behavior and functional interactions of TMEM30A in living cells.