Recombinant Pongo abelii Chloride intracellular channel protein 4 (CLIC4)

What is CLIC4 and what structural characteristics define it?

CLIC4 belongs to the chloride intracellular channel family of proteins, which have been implicated as intracellular chloride channels, though their precise physiological roles remain under investigation. The Pongo abelii (Sumatran orangutan) CLIC4 protein consists of 253 amino acids with a molecular weight of approximately 29 kDa . Its amino acid sequence includes characteristic domains that are conserved across species:

ALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVSTVDLKRKPADLQNLAPGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEALERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGDEMTLADCNLLPKLHIVKVVAKKYRNFDIPKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEISYSDVAKRLTK

The N-terminal region of CLIC4 (MALSMPLNGLKEED) has been used to generate specific antibodies against the protein, demonstrating its uniqueness within the CLIC family .

What are the optimal storage conditions for recombinant CLIC4 protein?

Recombinant Pongo abelii CLIC4 should be stored at -20°C for regular use, while extended storage requires conservation at -20°C or -80°C . The protein is typically supplied in a Tris-based buffer containing 50% glycerol that is optimized for protein stability . For short-term work, it is recommended to prepare working aliquots that can be stored at 4°C for up to one week . Importantly, repeated freezing and thawing cycles should be avoided as they can compromise protein integrity and functionality .

How can CLIC4 expression be detected in experimental samples?

Multiple approaches can be used to detect CLIC4 in experimental samples:

• Western blotting: Using specific antibodies such as AP255, which has been demonstrated to be highly specific for CLIC4 without cross-reactivity to other CLIC family members . This antibody recognizes the N-terminal sequence of mouse CLIC4 and can detect CLIC4 in tissue homogenates.

• Immunohistochemistry: CLIC4 expression patterns in tissues can be visualized using specific antibodies, as demonstrated in studies of renal tissue where CLIC4 was localized to the apical surface of proximal tubular epithelial cells .

• Immunofluorescence: This method provides higher resolution of subcellular localization and can be combined with other markers to determine colocalization patterns .

• Quantitative RT-PCR: For mRNA expression analysis, TaqMan QPCR assay using GAPDH as an internal standard has been successfully employed to detect CLIC4 transcript levels in various tissues .

What role does CLIC4 play in angiogenesis and tubulogenesis?

CLIC4 has been established as a critical protein in the process of angiogenesis, particularly through its function in cell-hollowing tubulogenesis. Studies using CLIC4 knockout mice have demonstrated:

• Defective angiogenesis in Matrigel plug assays

• Decreased development of retinal vasculature under both normal conditions and after oxygen toxicity challenge

• Impaired tubulogenesis in endothelial cells derived from CLIC4-/- mice when cultured in three-dimensional fibrin gels

Mechanistically, CLIC4 supports the acidification of vacuoles along the cell-hollowing tubulogenic pathway, which is essential for proper endothelial tube formation . It is hypothesized that CLIC4 provides a short-circuiting ion conductance that permits transport by the electrogenic vacuolar proton pump . This function appears to be evolutionarily conserved, as CLIC family members have been shown to be essential for the cell-hollowing tubulogenesis of the excretory cell in Caenorhabditis elegans .

What experimental approaches can be used to study CLIC4-mediated vacuolar acidification?

Researchers studying CLIC4's role in vacuolar acidification can employ several methodological approaches:

• pH-sensitive fluorescent probes: Intracellular compartment pH can be measured using ratiometric fluorescent dyes. In the published studies, compartments were labeled with Oregon Green 488 dextran, which exhibits pH-dependent fluorescence when excited at different wavelengths (488 or 543 nm) .

• Calibration with standard buffers: Accurate pH determination requires calibration with highly buffered, high potassium/nigericin solutions at known pH values (typically pH 5.5 and 7.0) to create a standardization curve for each experiment .

• Pharmacological inhibition: The use of specific inhibitors provides valuable information about CLIC4 function:

  • IAA-94, a CLIC inhibitor, blocks endothelial cell tubulogenesis

  • Bafilomycin A1, an inhibitor of vacuolar proton ATPase, also inhibits tubulogenesis, supporting the functional relationship between CLIC4 and the proton pump

• Differential interference contrast (DIC) optics: This technique allows for the identification of vacuolated cells for subsequent pH analysis .

How can researchers generate and validate CLIC4 knockout models?

The generation of CLIC4 knockout models provides valuable tools for investigating CLIC4 function. The process involves:

• Targeting vector construction: A targeting vector is designed to eliminate crucial exons. In the cited study, exon 2 of the CLIC4 gene was targeted for deletion . The vector contains:

  • Upstream and downstream fragments from adjacent introns

  • Selection markers (neomycin resistance for positive selection, thymidine kinase for negative selection)

• Embryonic stem cell transfection: The linearized targeting vector is introduced into embryonic stem cells by electroporation, followed by selection with G418 and ganciclovir .

• Screening for homologous recombination:

  • PCR screening of isolated colonies

  • Confirmation by Southern blotting of genomic DNA digested with appropriate restriction enzymes (NheI in the cited study)

• Chimera generation and breeding: Positive ES cells are injected into blastocysts to generate chimeric offspring, which are then bred with wild-type mice to establish heterozygous lines .

• Validation of knockout efficiency:

  • Quantitative RT-PCR to confirm absence of intact CLIC4 mRNA

  • Western blotting to verify absence of CLIC4 protein

  • Functional assays to demonstrate altered phenotypes

What is the relationship between CLIC4 and hypertensive nephropathy?

Recent proteomic studies have implicated CLIC4 in hypertensive nephropathy through the following findings:

• Differential expression: CLIC4 was found to be overexpressed in the renal parenchyma of spontaneously hypertensive rats (SHR) compared to normotensive Wistar Kyoto controls at multiple time points (6, 13, and 20 weeks after birth) .

• Subcellular localization: Immunohistochemistry and immunofluorescence studies demonstrated that CLIC4 is predominantly localized at the apical surface of proximal tubular epithelial cells in the kidney .

• Early involvement: The overexpression of CLIC4 was observed from the early stages of hypertension development, suggesting it may play a role in the pathogenesis rather than being merely a consequence of established disease .

• Associated pathways: Proteomic analysis identified several affected pathways and organelles (particularly mitochondria) from the early stages of hypertension, which may interact with CLIC4 function .

These findings suggest CLIC4 may be a novel component in the development of hypertension and nephrosclerosis, though the exact mechanisms require further investigation.

What controls should be included when studying recombinant CLIC4 specificity?

When studying recombinant CLIC4, researchers should implement multiple controls to ensure specificity:

• Antibody specificity validation:

  • Western blotting against multiple CLIC family members (CLIC1, CLIC4, CLIC5) to confirm antibody specificity

  • Peptide competition assays with the antigenic peptide to verify binding specificity

  • Testing against tissue homogenates known to express multiple CLIC proteins to confirm selective recognition

• Expression system controls:

  • Empty vector controls in recombinant expression systems

  • Non-related protein expression controls of similar size and properties

  • Species-specific controls when working with Pongo abelii CLIC4 versus other species variants

• Functional assays:

  • Pharmacological controls using specific inhibitors (IAA-94 for CLIC inhibition, bafilomycin A1 for vH-ATPase inhibition)

  • Genetic controls comparing wild-type and knockout models

  • Rescue experiments reintroducing CLIC4 into knockout systems to confirm phenotype reversal

How should researchers address potential functional redundancy with other CLIC family members?

CLIC4 belongs to a family of six mammalian CLIC proteins that may have overlapping functions. To address potential redundancy:

• Expression profiling: Comprehensive analysis of all CLIC family members in the tissue or cell type of interest to identify which members are co-expressed with CLIC4.

• Compensatory expression analysis: Assessment of whether other CLIC family members show altered expression in CLIC4 knockout models, which might indicate compensatory mechanisms.

• Double/triple knockout approaches: Generation of multiple CLIC knockout models to eliminate potential redundant functions.

• Domain-specific studies: Analysis of unique domains or post-translational modifications that might confer specific functions to CLIC4 compared to other family members.

• Subcellular localization comparison: Detailed mapping of the subcellular distribution of different CLIC proteins to identify unique localization patterns that might suggest non-redundant functions.

• Tissue-specific conditional knockouts: Generation of tissue-specific CLIC4 deletion to avoid developmental compensation that might occur in constitutive knockout models.

What methods can be used to study CLIC4 ion channel activity?

Although CLIC4 has been implicated as a chloride channel, its precise ion channel characteristics remain under investigation. Researchers can employ several techniques:

• Electrophysiological methods:

  • Patch-clamp recording of cells overexpressing CLIC4

  • Reconstitution of purified CLIC4 in lipid bilayers to measure single-channel properties

  • Whole-cell recording to measure chloride currents in wild-type versus CLIC4 knockout cells

• Ion flux assays:

  • Fluorescent chloride indicators to measure intracellular chloride concentrations

  • Radioactive chloride uptake assays in vesicles containing reconstituted CLIC4

  • pH-sensitive dyes to monitor coupling between proton pump activity and chloride conductance

• Structure-function studies:

  • Site-directed mutagenesis of putative pore-forming regions

  • Chimeric proteins between different CLIC family members

  • Structural studies using crystallography or cryo-EM to identify conformational changes associated with channel activity

What analytical techniques are recommended for studying CLIC4 in proteomic studies?

Proteomic analysis of CLIC4 can be approached through:

• Two-dimensional gel electrophoresis: This technique was successfully used to identify differential expression of CLIC4 in spontaneously hypertensive rats compared to normotensive controls . The approach involves:

  • Protein extraction from tissue samples

  • First-dimension separation by isoelectric focusing

  • Second-dimension separation by SDS-PAGE

  • Protein identification by mass spectrometry

• Mass spectrometry-based approaches:

  • Shotgun proteomics using liquid chromatography coupled to tandem mass spectrometry (LC-MS/MS)

  • Targeted proteomics using selected reaction monitoring (SRM) or parallel reaction monitoring (PRM)

  • Post-translational modification analysis using enrichment strategies coupled with MS detection

• Protein interaction studies:

  • Co-immunoprecipitation followed by mass spectrometry

  • Proximity labeling techniques such as BioID or APEX

  • Cross-linking mass spectrometry to identify direct interaction partners

• Quantitative proteomics:

  • Stable isotope labeling (SILAC, TMT, iTRAQ) for accurate quantification

  • Label-free quantification approaches

  • Absolute quantification using synthetic peptide standards

How should researchers interpret seemingly contradictory findings about CLIC4 function?

Reconciling contradictory findings about CLIC4 requires systematic approaches:

• Context-dependent function analysis:

  • Evaluate cell type-specific effects (e.g., endothelial cells versus proximal tubular epithelial cells)

  • Consider developmental stage differences (embryonic versus adult expression patterns)

  • Assess species-specific variations (Pongo abelii versus mouse or human CLIC4)

• Methodological considerations:

  • Compare in vitro versus in vivo experimental systems

  • Evaluate acute versus chronic manipulations of CLIC4 activity

  • Consider differences in experimental conditions (pH, ionic strength, temperature)

• Quantitative analysis framework:

  • Develop mathematical models of CLIC4 function that incorporate multiple parameters

  • Use sensitivity analysis to identify key variables affecting CLIC4 activity

  • Implement systems biology approaches to integrate CLIC4 into broader cellular networks

• Resolution strategies:

  • Design critical experiments that directly test competing hypotheses

  • Use multiple complementary techniques to validate findings

  • Collaborate with laboratories reporting contradictory results to standardize methodologies

What statistical considerations are important when analyzing CLIC4 expression data?

When analyzing CLIC4 expression data, researchers should consider:

• Sample size determination:

  • Power analysis to ensure adequate statistical power for detecting biologically relevant differences

  • Consideration of effect size estimates based on preliminary data or literature

• Appropriate statistical tests:

  • Parametric tests (t-test, ANOVA) for normally distributed data

  • Non-parametric alternatives (Mann-Whitney, Kruskal-Wallis) for non-normal distributions

  • Multiple comparison corrections (Bonferroni, Benjamini-Hochberg) for high-dimensional data

• Correlation analyses:

  • Assessment of relationships between CLIC4 expression and functional parameters

  • Multivariate analyses to account for confounding variables

  • Regression models to quantify the contribution of CLIC4 to observed phenotypes

• Reproducibility considerations:

  • Biological versus technical replicates

  • Batch effect correction in large-scale studies

  • Standardization of normalization methods across studies