Recombinant Pongo abelii CKLF-like MARVEL transmembrane domain-containing protein 6 (CMTM6)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pongo abelii CKLF-like MARVEL Transmembrane Domain-Containing Protein 6 (CMTM6)

Recombinant Pongo abelii CKLF-like MARVEL transmembrane domain-containing protein 6 (CMTM6) is a recombinant form of the protein CMTM6 derived from the Sumatran orangutan (Pongo abelii). This protein belongs to the CKLF-like MARVEL transmembrane domain-containing family, which plays significant roles in various biological processes, including immune regulation and cancer development. CMTM6 is particularly noted for its role in stabilizing the expression of PD-L1, a protein involved in immune checkpoint mechanisms that can prevent the immune system from attacking cancer cells.

Structure and Function of CMTM6

CMTM6 is a transmembrane protein with a structure similar to that of chemokine proteins and tetraspanins. It contains MARVEL domains, which are characteristic of proteins involved in membrane trafficking and junction formation. The protein is expressed in various tissues and localizes to the plasma membrane, lysosomes, endosomes, cytosol, and extracellular spaces.

Characteristics of Recombinant Pongo abelii CMTM6Description
SourceIn vitro E. coli expression system
Immunogen SpeciesPongo abelii (Sumatran orangutan)
SequenceMENGAVYSPTTEEDPGPARGPRSGLAAYCFLGRLPLLRRVLKGLQLSLSLLAFICEEVVS...
Tag InfoN-terminal 10xHis-tagged
Protein LengthFull-length protein (1-183 amino acids)
Storage ConditionsStore at -20°C or -80°C

Biological Role of CMTM6

CMTM6 is crucial for maintaining the cell surface expression of PD-L1 by preventing its lysosomal degradation. This function is essential for immune tolerance and can be exploited by cancer cells to evade immune destruction. CMTM6 also influences tumor immunity by regulating PD-L1 expression on tumor cells, which suppresses T-cell responses.

Research Findings and Applications

Recent studies have highlighted the prognostic value of CMTM6 expression in various cancers. For instance, high CMTM6 expression is associated with improved prognosis in ovarian cancer but poorer outcomes in non-small cell lung cancer. The protein's role in modulating immune responses and its interaction with PD-L1 make it a potential target for cancer therapies.

Cancer TypeEffect of High CMTM6 ExpressionReferences
Ovarian CancerImproved prognosis
Non-Small Cell Lung CancerPoorer prognosis

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
CMTM6; CKLFSF6; CKLF-like MARVEL transmembrane domain-containing protein 6; Chemokine-like factor superfamily member 6
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-183
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
CMTM6
Target Protein Sequence
MENGAVYSPTTEEDPGPARGPRSGLAAYCFLGRLPLLRRVLKGLQLSLSLLAFICEEVVS QCTLCGGLYFFEFVSCSAFLLSLLILIVYCTPFYERVDTTKVKSSDFYITLGTGCVFLLA SIIFVSTHDRTSAEIAAIVFGFIASFMFLLDFVTMLYEKRQESQLRKSENTTRAEALTEP LNA
Uniprot No.

Target Background

Function
A master regulator of PD-L1/CD274 (an immune inhibitory ligand crucial for self-tolerance and antitumor immunity) recycling and plasma membrane expression. It associates with both constitutive and IFNγ-induced PD-L1/CD274 at recycling endosomes, protecting it from lysosomal degradation, possibly by inhibiting ubiquitination. This may stabilize PD-L1/CD274 expression on antigen-presenting cells and enhance inhibitory signaling by its receptor, PDCD1/CD279 (on T cells), leading to T-cell anergy.
Database Links
Protein Families
Chemokine-like factor family
Subcellular Location
Cell membrane; Multi-pass membrane protein. Early endosome membrane; Multi-pass membrane protein. Recycling endosome membrane.

Q&A

What methodological approaches are recommended for studying CMTM6-PD-L1 interactions in Pongo abelii models?

To effectively study CMTM6-PD-L1 interactions in Pongo abelii models, researchers should employ a multi-faceted approach:

Protein-Protein Interaction Analyses:

  • Co-immunoprecipitation: Using antibodies against Pongo abelii CMTM6 to pull down protein complexes and identify PD-L1 association through Western blotting

  • Proximity ligation assays: Visualizing direct protein interactions in situ with species-specific antibodies

  • FRET/BRET assays: Quantifying protein proximity through fluorescence or bioluminescence resonance energy transfer

Cellular Localization Studies:

  • Confocal microscopy: Examining co-localization at the plasma membrane and in recycling endosomes as demonstrated in human studies

  • Live-cell imaging: Tracking protein trafficking dynamics in real-time

  • Subcellular fractionation: Biochemically separating membrane compartments to quantify CMTM6 and PD-L1 co-distribution

Functional Assessment:

  • CRISPR-Cas9 gene editing: Creating CMTM6 knockout Pongo abelii cell lines to observe effects on PD-L1 stability

  • Pulse-chase experiments: Measuring PD-L1 half-life with or without CMTM6 expression

  • Flow cytometry: Quantifying surface PD-L1 levels under various conditions

Comparative Approaches:

  • Cross-species complementation: Testing whether human CMTM6 can rescue phenotypes in Pongo abelii CMTM6-deficient cells

  • Domain swapping experiments: Creating chimeric proteins to identify regions responsible for species-specific functions

These methodologies should be adapted with appropriate controls and species-specific reagents to ensure reliable results in non-human primate models.

What expression systems are most appropriate for producing functional recombinant Pongo abelii CMTM6?

The selection of an appropriate expression system is critical for producing functional recombinant Pongo abelii CMTM6. Based on available data and the protein's characteristics, several systems can be considered:

Mammalian Expression Systems:

  • HEK293 cells: Most appropriate for maintaining native conformation and post-translational modifications, as evidenced by successful production of human CMTM6 cell lysates

  • CHO cells: Useful for large-scale production with mammalian processing capabilities

  • Optimal conditions: Culture at 37°C, 5% CO2, using vectors with strong promoters (CMV)

Insect Cell Systems:

  • Sf9/Sf21 cells: Provide a compromise between proper folding of membrane proteins and higher yield

  • High Five cells: Potentially useful for increased expression levels

coli Systems (with limitations):

  • Should be considered only for soluble domains: The transmembrane nature of CMTM6 makes bacterial expression challenging

  • Specialized strains: C41(DE3), C43(DE3) designed for membrane protein expression

Expression Considerations:

  • Tags: Strategic placement of purification tags (His, GST, etc.) to avoid interfering with functional domains

  • Temperature modulation: Lower temperatures (16-25°C) often improve folding of complex proteins

  • Induction protocols: Gentle induction for membrane proteins to allow proper integration into membranes

  • Solubilization methods: Appropriate detergents for extraction while maintaining native structure

Based on commercial sources, recombinant Pongo abelii CMTM6 is typically produced with expression tags in mammalian cells, suggesting this is the most reliable approach for functional protein production .

How does CMTM6 affect immune cell function in tumor microenvironments, and how might this differ between humans and Pongo abelii?

CMTM6 has significant effects on the tumor immune microenvironment through multiple mechanisms:

Human CMTM6 Immune Effects:

  • PD-L1 Stabilization: CMTM6 maintains PD-L1 on the tumor cell surface, enhancing immune evasion through PD-1/PD-L1 interaction

  • Immune Cell Infiltration: CMTM6 expression correlates with specific immune cell infiltration patterns:

    • Positively correlated with Th2 cells and regulatory T cells (Tregs)

    • Negatively correlated with CD8+ T cells, Th1 cells, and natural killer T cells

  • Immunomodulatory Effects:

    • CMTM6 expression correlates with multiple immunoinhibitors (PD-L1, TIM-3, B7-H3)

    • Knockout of CMTM6 promotes CD8+ T cell infiltration and enhances anti-tumor immunity

Potential Differences in Pongo abelii:

Research Implications:

  • Comparative studies between human and Pongo abelii CMTM6 could reveal:

    • Conserved mechanisms essential for immune regulation across primates

    • Adaptations specific to human cancer development

    • Novel therapeutic targets with potentially fewer off-target effects

A significant research finding indicates that CMTM6 may have PD-L1-independent functions in immune regulation, as "CMTM6 suppression still significantly dampened tumor growth dependent on cytotoxic cells" even "without the PD-1/PD-L1 axis" . This suggests additional mechanisms that warrant investigation in comparative primate studies.

What experimental controls are essential when studying Pongo abelii CMTM6 in comparative immunology research?

Rigorous experimental controls are crucial when conducting comparative immunology research with Pongo abelii CMTM6:

Species-Specific Controls:

  • Positive controls: Include well-characterized human CMTM6 samples alongside Pongo abelii CMTM6

  • Negative controls: Generate CMTM6-knockout cell lines from both species to establish baseline measurements

  • Cross-reactivity validation: Thoroughly test antibodies and detection reagents against both species' proteins

Functional Controls:

  • Related family members: Include CMTM4 (which shows overlapping functions with CMTM6 ) to control for family-specific effects

  • Protein expression normalization: Ensure comparable expression levels when comparing functions across species

  • Cellular context controls: Test in matched cell types from both species to account for cell-specific effects

Technical Controls:

  • Recombinant protein standards: Include purified proteins of known concentration for quantitative comparisons

  • Vector controls: Use identical expression vectors with species-specific sequence variations

  • Environmental variables: Maintain identical experimental conditions (temperature, media, timing) across all comparative experiments

Validation Controls:

  • Multiple methodological approaches: Confirm findings using independent techniques

  • Dose-response relationships: Test across concentration ranges to identify potential differences in sensitivity

  • Time-course analyses: Evaluate kinetic differences that might not be apparent at single timepoints

Control TypeHuman SamplePongo abelii SamplePurpose
GeneticCMTM6 wildtypeCMTM6 wildtypeBaseline comparison
GeneticCMTM6 knockoutCMTM6 knockoutFunctional validation
ProteinRecombinant human CMTM6Recombinant Pongo abelii CMTM6Direct protein comparison
FamilyCMTM4 expressionCMTM4 expressionFunctional redundancy assessment
TechnicalVector onlyVector onlyExpression system control

These controls ensure that observed differences reflect true biological variation rather than technical artifacts or methodological inconsistencies.

How should researchers interpret differences in CMTM6 function between human and Pongo abelii models?

When interpreting differences in CMTM6 function between human and Pongo abelii models, researchers should consider multiple factors:

Evolutionary Context:

  • Divergence timeline: Humans and orangutans diverged approximately 12-16 million years ago, allowing for functional adaptations

  • Selection pressures: Different pathogen exposures may have driven species-specific immune adaptations

  • Genomic context: Changes in interacting partners or regulatory networks might influence functional outcomes

Technical Considerations:

  • Reagent cross-reactivity: Antibodies or detection systems may have different affinities for each species' proteins

  • Expression system artifacts: Heterologous expression might not recapitulate native conditions

  • Cellular context differences: The broader signaling environment might differ between species

Analytical Framework:

  • Establish confidence in the observation: Confirm differences through multiple experimental approaches

  • Quantify the magnitude: Determine whether differences are substantial or subtle variations around similar functions

  • Localize the differences: Map variations to specific protein domains or activities

  • Consider functional consequences: Assess the biological significance of any observed differences

  • Develop testable explanations: Generate hypotheses about why the differences evolved

Reporting Guidelines:

  • Clearly distinguish between directly observed differences and inferred functional implications

  • Acknowledge limitations in cross-species comparisons

  • Provide quantitative measures of difference when possible

  • Consider alternative explanations for observed variations

  • Contextualize findings within broader evolutionary patterns

Research with Pongo abelii models offers valuable opportunities to understand the evolution of immune regulation, but requires careful interpretation to avoid anthropomorphizing non-human systems or overlooking important species-specific adaptations.

How can gene editing approaches be used to study CMTM6 function in Pongo abelii cells?

Gene editing technologies offer powerful approaches to investigate CMTM6 function in Pongo abelii cells:

CRISPR-Cas9 Applications:

  • Complete knockout studies: Generate CMTM6-null Pongo abelii cells to assess effects on PD-L1 stability and immune response

  • Domain-specific mutations: Introduce targeted modifications to functional domains to assess their importance

  • Knock-in approaches: Tag endogenous CMTM6 with fluorescent proteins or affinity tags for visualization and purification

  • Promoter modification: Alter expression levels to study dose-dependent effects

Experimental Design Considerations:

  • Guide RNA design: Account for species-specific sequence variations when designing gRNAs

  • Off-target analysis: Thoroughly validate specificity in the Pongo abelii genome

  • Delivery methods: Optimize transfection or transduction protocols for orangutan cells

  • Clone selection: Use single-cell derivation to ensure genetic homogeneity

Functional Validation Approaches:

  • Complementation studies: Rescue phenotypes with wild-type or mutant CMTM6 to confirm specificity

  • Cross-species complementation: Test whether human CMTM6 can functionally replace the orangutan version

  • Dose-response relationships: Create cells with varying CMTM6 expression levels

  • Interaction partner screening: Identify species-specific CMTM6 binding partners using proximity labeling

Potential Applications:

  • Creating cellular models to study evolutionary conservation of CMTM6-PD-L1 regulation

  • Investigating species-specific differences in CMTM6's impact on immune evasion

  • Developing platforms for testing therapeutic strategies targeting CMTM6

  • Exploring PD-L1-independent functions through specific domain mutations

Research has already demonstrated that "ablation of CMTM6 significantly reduced human and murine tumor growth in a manner dependent on T-cell immunity" . Similar approaches in Pongo abelii cells could reveal whether this function is conserved across primates and provide insights into the evolutionary development of immune evasion mechanisms.

What role does CMTM6 play in cancer immunotherapy resistance, and how can Pongo abelii models contribute to this research?

CMTM6 has emerged as a significant factor in cancer immunotherapy resistance through several mechanisms:

CMTM6 Contributions to Therapy Resistance:

  • PD-L1 Stabilization: CMTM6 prevents PD-L1 degradation, enhancing the PD-1/PD-L1 immune checkpoint

  • Predictive Biomarker Potential: Studies show "CMTM6 was also found to be an independent predictor of the response to PD-1 inhibitors"

  • Beyond PD-L1: Evidence indicates CMTM6 suppression "broke resistance to immune-checkpoint inhibitors and remodeled the tumor immune microenvironment"

  • Tumor Progression Correlation: "CMTM6 expression increased with tumor progression in both patients and mice"

How Pongo abelii Models Can Contribute:

  • Evolutionary Insights: Comparing human and orangutan CMTM6 can reveal conserved mechanisms essential for immune evasion

  • Novel Target Identification:

    • Studying differences may identify regions less essential for normal function but critical for immune evasion

    • Research shows CMTM6 targeting can be effective: "gene therapy targeting CMTM6 is a promising strategy for cancer immunotherapy"

  • Improved Animal Models: Findings from orangutan studies could inform more relevant preclinical models

  • Mechanism Elucidation: Cross-species comparison can help distinguish general from human-specific resistance mechanisms

Research Approaches Using Pongo abelii:

  • Comparative binding studies: Assess differences in CMTM6-PD-L1 interaction strength

  • Domain mapping: Identify species-specific variations in functional domains

  • Response comparison: Measure differences in immune activation when CMTM6 is inhibited

  • Therapeutic testing: Evaluate whether anti-CMTM6 approaches effective in human models work similarly in orangutan cells

Studies have demonstrated that "CMTM6 depletion, via the reduction of PD-L1, significantly alleviates the suppression of tumor-specific T cell activity in vitro and in vivo" , suggesting that comparative studies could yield valuable insights into conserved mechanisms of immune evasion that might be more safely targeted in cancer therapy.

What are the optimal purification strategies for recombinant Pongo abelii CMTM6?

Purifying recombinant Pongo abelii CMTM6 requires specialized approaches due to its transmembrane nature:

Extraction and Solubilization:

  • Detergent selection: Mild non-ionic or zwitterionic detergents (DDM, CHAPS, or Digitonin) preserve native structure

  • Membrane preparation: Careful fractionation of cellular membranes before solubilization

  • Alternative approaches: Consider native nanodiscs or styrene-maleic acid copolymer lipid particles (SMALPs) for detergent-free extraction

Chromatography Strategy:

  • Affinity chromatography: Primary capture based on fusion tags (His, GST, etc.)

  • Ion exchange chromatography: Secondary purification exploiting the protein's charge properties

  • Size exclusion chromatography: Final polishing step and buffer exchange

  • Specialized techniques: Lipid-based chromatography for maintaining membrane protein structure

Critical Parameters:

  • Buffer optimization: Include glycerol (typically 50%) and appropriate detergent concentrations

  • Temperature control: Maintain 4°C throughout purification to minimize degradation

  • Protease inhibitors: Include complete protease inhibitor cocktails

  • Reducing agents: Maintain appropriate redox conditions for structural integrity

  • pH considerations: Optimize based on the protein's theoretical isoelectric point

Quality Control:

  • Purity assessment: SDS-PAGE, Western blotting, and mass spectrometry

  • Functional validation: PD-L1 binding assays to confirm activity

  • Structural integrity: Circular dichroism or other spectroscopic methods

  • Aggregation monitoring: Dynamic light scattering or analytical size exclusion

Storage Recommendations:

  • Short-term storage: 4°C in optimized buffer with detergents

  • Long-term preservation: Aliquot and store at -80°C with cryoprotectants

  • Avoid repeated freeze-thaw cycles: "Repeated freezing and thawing is not recommended"

When working with recombinant Pongo abelii CMTM6, researchers should pay particular attention to maintaining the native membrane environment or suitable mimetics throughout purification to preserve functional activity.

What techniques can assess the evolutionary conservation of CMTM6 function across primates?

Investigating the evolutionary conservation of CMTM6 function across primates requires a multi-disciplinary approach:

Sequence-Based Analyses:

  • Multiple sequence alignment: Compare CMTM6 sequences across primate species to identify conserved domains

  • Phylogenetic reconstruction: Establish evolutionary relationships and divergence patterns

  • Selection pressure analysis: Calculate dN/dS ratios to identify regions under purifying or positive selection

  • Ancestral sequence reconstruction: Infer the sequence of CMTM6 in the common ancestor of humans and orangutans

Structural Biology Approaches:

  • Comparative modeling: Generate and compare 3D structure predictions of CMTM6 from different primates

  • Molecular dynamics simulations: Assess how sequence differences might affect protein dynamics

  • Binding site analysis: Identify and compare potential interaction surfaces for PD-L1 and other partners

  • Domain architecture comparison: Evaluate conservation of functional modules across species

Functional Comparisons:

  • Cross-species binding assays: Measure interaction strength between CMTM6 and PD-L1 from different primates

  • Chimeric protein studies: Create fusion proteins with domains from different species to map functional regions

  • Complementation experiments: Test whether CMTM6 from one species can restore function in cells from another species

  • Equivalent mutation effects: Determine if the same mutations have consistent effects across species

Expression Pattern Analysis:

  • Comparative transcriptomics: Analyze expression patterns across tissues in different primates

  • Regulatory element comparison: Identify conserved and divergent promoter and enhancer regions

  • Single-cell expression profiling: Compare cell type-specific expression across species

These approaches can help distinguish universal features of CMTM6 function from species-specific adaptations, providing insights into both fundamental biology and potential therapeutic applications targeting conserved mechanisms.

How can researchers quantitatively measure CMTM6's effect on PD-L1 stability in Pongo abelii cells?

Quantitative measurement of CMTM6's effect on PD-L1 stability in Pongo abelii cells requires rigorous methodological approaches:

Protein Half-Life Determination:

  • Pulse-chase experiments: Label newly synthesized proteins with radioactive amino acids or click chemistry and track degradation over time

  • Cycloheximide chase assays: Block new protein synthesis and measure PD-L1 degradation rate with or without CMTM6

  • Time-course flow cytometry: Monitor surface PD-L1 levels after blocking transport from Golgi (Brefeldin A treatment)

Molecular Interaction Quantification:

  • Surface plasmon resonance (SPR): Determine binding kinetics and affinity between purified Pongo abelii CMTM6 and PD-L1

  • Microscale thermophoresis (MST): Measure interaction parameters in solution

  • Bio-layer interferometry (BLI): Analyze real-time binding interactions

Advanced Imaging Approaches:

  • Fluorescence recovery after photobleaching (FRAP): Measure membrane dynamics of fluorescently tagged PD-L1 with or without CMTM6

  • Förster resonance energy transfer (FRET): Quantify protein proximity in living cells

  • Single-molecule tracking: Follow individual PD-L1 molecules to assess diffusion rates and endocytic events

Pathway-Specific Analyses:

  • Ubiquitination assays: Compare PD-L1 ubiquitination levels in the presence or absence of CMTM6

  • Endosomal trafficking analysis: Track co-localization with endosomal markers using quantitative image analysis

  • Lysosomal degradation measurement: Assess PD-L1 accumulation after lysosomal inhibitor treatment

Experimental Design Considerations:

  • Use matched CMTM6 knockout and wildtype Pongo abelii cell lines

  • Create dose-responsive systems with tunable CMTM6 expression

  • Include both steady-state and dynamic measurements

  • Normalize to appropriate housekeeping controls

  • Perform parallel experiments with human cells for direct comparison

Research has shown that in human cells, "CMTM6 is not required for PD-L1 maturation but co-localizes with PD-L1 at the plasma membrane and in recycling endosomes, where it prevents PD-L1 from being targeted for lysosome-mediated degradation" . Quantitative approaches can determine whether this mechanism is conserved in Pongo abelii and identify any species-specific variations in efficiency or regulation.

What are the potential differences in CMTM6 expression patterns between human and Pongo abelii tissues?

Understanding differences in CMTM6 expression patterns between human and Pongo abelii tissues requires comprehensive comparative analysis:

Methodological Approaches for Comparison:

  • Cross-species transcriptomics: Analyze RNA-seq data from matched tissues when available

  • Comparative immunohistochemistry: Use validated antibodies with confirmed cross-reactivity

  • Quantitative PCR: Measure expression levels with species-specific primers

  • In situ hybridization: Visualize expression patterns in tissue contexts

  • Single-cell RNA sequencing: Compare cell type-specific expression profiles

Potential Expression Differences:

  • Tissue distribution: Variations in which tissues express the highest levels of CMTM6

  • Developmental timing: Differences in expression during various developmental stages

  • Response to stimuli: Divergent regulation in response to immune activation or stress

  • Splice variant predominance: Different isoforms may be expressed preferentially

  • Subcellular localization: Variations in protein distribution within cells

Functional Implications:

  • Differences in tissue expression could reflect evolutionary adaptations to specific immune challenges

  • Variations might contribute to differences in disease susceptibility between species

  • Expression pattern differences could affect the suitability of targeting CMTM6 therapeutically

While specific comparative data between human and Pongo abelii CMTM6 expression is limited, human CMTM6 is "ubiquitously expressed" and "widely expressed in many tissues" . The high conservation of the protein suggests similar broad expression in orangutans, though species-specific differences likely exist, particularly in immune-related tissues where evolutionary pressures may have driven divergent regulation.

How does CMTM6 interact with other components of the immune checkpoint system beyond PD-L1?

CMTM6 exhibits significant interactions with multiple components of the immune checkpoint system beyond its well-established role in stabilizing PD-L1:

CMTM6 Correlations with Other Immune Checkpoints:

  • Multiple Immunoinhibitors: Research shows CMTM6 expression correlates with numerous immunoinhibitory molecules:

    • "CMTM6 expression was correlated with 24 immunoinhibitors, of which 23 were positively correlated with PDCD1, CD274, CD244, CD96, CTLA4, HAVCR2, IL-10"

  • Immunostimulatory Molecules: Also shows significant correlation with stimulatory checkpoints:

    • "CMTM6 expression was correlated with 45 immunostimulators, of which only LTA and TNFRSF13C were negatively correlated with CMTM6, and 43 immunostimulators such as CD27, CD28, CD40, CD48, CD80, CXCL12, CXCR4 and IL-6 were positively correlated"

Beyond PD-L1 Stabilization:

  • PD-L1-Independent Functions: Evidence indicates CMTM6 has functions beyond PD-L1:

    • "Without the PD-1/PD-L1 axis, CMTM6 suppression still significantly dampened tumor growth dependent on cytotoxic cells"

  • Immune Cell Expression: "CMTM6 was widely expressed on immune cells"

  • T Cell Intrinsic Functions: "T-cell CMTM6 levels increased with sustained immune activation and intratumoral immune exhaustion and affected T cell–intrinsic PD-L1 levels"

Chemokine System Interactions:

  • Extensive Chemokine Correlations: "CMTM6 was positively correlated with 26 chemokines such as CCL2-5, CXCL1-3, CXCL8-14 and 10 chemokine receptors such as CCR1, CCR2, CXCR1"

  • Family Relationship: CMTM6 belongs to a family with structural similarity to chemokines, suggesting potential functional overlap

Research Implications:

These multiple interactions suggest CMTM6 may function as a broader immune regulatory hub rather than simply a PD-L1 stabilizer. Comparative studies between human and Pongo abelii could reveal which of these interactions are evolutionarily conserved and potentially fundamental to immune regulation versus those that might represent species-specific adaptations.

The finding that "host CMTM6 knockout significantly restrained tumor growth in a manner dependent on CD8+ T cells and not entirely dependent on PD-L1" highlights the importance of investigating these broader immune regulatory functions.

What quality control measures are essential for validating antibodies against Pongo abelii CMTM6?

Rigorous quality control is crucial when validating antibodies against Pongo abelii CMTM6 to ensure specific and reliable detection:

Specificity Validation:

  • Western blot analysis:

    • Test against recombinant Pongo abelii CMTM6

    • Compare with CMTM6-knockout cell lysates as negative controls

    • Check for cross-reactivity with other CMTM family members, particularly CMTM4 which shares functional overlap

  • Immunoprecipitation followed by mass spectrometry: Confirm that the antibody specifically pulls down CMTM6

  • Peptide competition assays: Verify that specific peptides can block antibody binding

Cross-reactivity Assessment:

  • Species cross-reactivity testing: Determine binding to human CMTM6 and other primate CMTM6 proteins

  • Epitope mapping: Identify the specific binding site to assess conservation across species

  • ELISA-based quantification: Measure binding affinity to different species' CMTM6

Application-specific Validation:

  • Immunohistochemistry controls:

    • Use CMTM6-transfected and knockout cells as positive and negative controls

    • Compare staining patterns with mRNA expression data

  • Flow cytometry validation:

    • Test on cells with manipulated CMTM6 expression levels

    • Compare surface vs. permeabilized staining to confirm expected localization

  • Immunofluorescence specificity:

    • Co-localization with other markers of expected subcellular compartments

    • Signal absence in knockout cells

Reproducibility Testing:

  • Lot-to-lot consistency: Test multiple antibody lots for consistent performance

  • Inter-laboratory validation: Confirm results across different research settings

  • Different sample preparations: Verify performance in fixed vs. frozen tissues, native vs. denatured proteins

Documentation Requirements:

  • Complete validation data should be recorded, including:

    • Positive and negative controls used

    • All testing conditions and protocols

    • Images of original blots or staining results

    • Quantitative measures of specificity and sensitivity

    • Any observed limitations or cross-reactivity

These quality control measures ensure that research findings based on antibody detection of Pongo abelii CMTM6 are reliable and reproducible, providing a solid foundation for comparative studies with human CMTM6.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.