Recombinant Pongo abelii CKLF-like MARVEL transmembrane domain-containing protein 6 (CMTM6) is a recombinant form of the protein CMTM6 derived from the Sumatran orangutan (Pongo abelii). This protein belongs to the CKLF-like MARVEL transmembrane domain-containing family, which plays significant roles in various biological processes, including immune regulation and cancer development. CMTM6 is particularly noted for its role in stabilizing the expression of PD-L1, a protein involved in immune checkpoint mechanisms that can prevent the immune system from attacking cancer cells.
CMTM6 is a transmembrane protein with a structure similar to that of chemokine proteins and tetraspanins. It contains MARVEL domains, which are characteristic of proteins involved in membrane trafficking and junction formation. The protein is expressed in various tissues and localizes to the plasma membrane, lysosomes, endosomes, cytosol, and extracellular spaces.
| Characteristics of Recombinant Pongo abelii CMTM6 | Description |
|---|---|
| Source | In vitro E. coli expression system |
| Immunogen Species | Pongo abelii (Sumatran orangutan) |
| Sequence | MENGAVYSPTTEEDPGPARGPRSGLAAYCFLGRLPLLRRVLKGLQLSLSLLAFICEEVVS... |
| Tag Info | N-terminal 10xHis-tagged |
| Protein Length | Full-length protein (1-183 amino acids) |
| Storage Conditions | Store at -20°C or -80°C |
CMTM6 is crucial for maintaining the cell surface expression of PD-L1 by preventing its lysosomal degradation. This function is essential for immune tolerance and can be exploited by cancer cells to evade immune destruction. CMTM6 also influences tumor immunity by regulating PD-L1 expression on tumor cells, which suppresses T-cell responses.
Recent studies have highlighted the prognostic value of CMTM6 expression in various cancers. For instance, high CMTM6 expression is associated with improved prognosis in ovarian cancer but poorer outcomes in non-small cell lung cancer. The protein's role in modulating immune responses and its interaction with PD-L1 make it a potential target for cancer therapies.
KEGG: pon:100171512
STRING: 9601.ENSPPYP00000015709
To effectively study CMTM6-PD-L1 interactions in Pongo abelii models, researchers should employ a multi-faceted approach:
Co-immunoprecipitation: Using antibodies against Pongo abelii CMTM6 to pull down protein complexes and identify PD-L1 association through Western blotting
Proximity ligation assays: Visualizing direct protein interactions in situ with species-specific antibodies
FRET/BRET assays: Quantifying protein proximity through fluorescence or bioluminescence resonance energy transfer
Confocal microscopy: Examining co-localization at the plasma membrane and in recycling endosomes as demonstrated in human studies
Live-cell imaging: Tracking protein trafficking dynamics in real-time
Subcellular fractionation: Biochemically separating membrane compartments to quantify CMTM6 and PD-L1 co-distribution
CRISPR-Cas9 gene editing: Creating CMTM6 knockout Pongo abelii cell lines to observe effects on PD-L1 stability
Pulse-chase experiments: Measuring PD-L1 half-life with or without CMTM6 expression
Flow cytometry: Quantifying surface PD-L1 levels under various conditions
Cross-species complementation: Testing whether human CMTM6 can rescue phenotypes in Pongo abelii CMTM6-deficient cells
Domain swapping experiments: Creating chimeric proteins to identify regions responsible for species-specific functions
These methodologies should be adapted with appropriate controls and species-specific reagents to ensure reliable results in non-human primate models.
The selection of an appropriate expression system is critical for producing functional recombinant Pongo abelii CMTM6. Based on available data and the protein's characteristics, several systems can be considered:
HEK293 cells: Most appropriate for maintaining native conformation and post-translational modifications, as evidenced by successful production of human CMTM6 cell lysates
CHO cells: Useful for large-scale production with mammalian processing capabilities
Optimal conditions: Culture at 37°C, 5% CO2, using vectors with strong promoters (CMV)
Sf9/Sf21 cells: Provide a compromise between proper folding of membrane proteins and higher yield
High Five cells: Potentially useful for increased expression levels
Should be considered only for soluble domains: The transmembrane nature of CMTM6 makes bacterial expression challenging
Specialized strains: C41(DE3), C43(DE3) designed for membrane protein expression
Tags: Strategic placement of purification tags (His, GST, etc.) to avoid interfering with functional domains
Temperature modulation: Lower temperatures (16-25°C) often improve folding of complex proteins
Induction protocols: Gentle induction for membrane proteins to allow proper integration into membranes
Solubilization methods: Appropriate detergents for extraction while maintaining native structure
Based on commercial sources, recombinant Pongo abelii CMTM6 is typically produced with expression tags in mammalian cells, suggesting this is the most reliable approach for functional protein production .
CMTM6 has significant effects on the tumor immune microenvironment through multiple mechanisms:
PD-L1 Stabilization: CMTM6 maintains PD-L1 on the tumor cell surface, enhancing immune evasion through PD-1/PD-L1 interaction
Immune Cell Infiltration: CMTM6 expression correlates with specific immune cell infiltration patterns:
Immunomodulatory Effects:
Comparative studies between human and Pongo abelii CMTM6 could reveal:
Conserved mechanisms essential for immune regulation across primates
Adaptations specific to human cancer development
Novel therapeutic targets with potentially fewer off-target effects
A significant research finding indicates that CMTM6 may have PD-L1-independent functions in immune regulation, as "CMTM6 suppression still significantly dampened tumor growth dependent on cytotoxic cells" even "without the PD-1/PD-L1 axis" . This suggests additional mechanisms that warrant investigation in comparative primate studies.
Rigorous experimental controls are crucial when conducting comparative immunology research with Pongo abelii CMTM6:
Positive controls: Include well-characterized human CMTM6 samples alongside Pongo abelii CMTM6
Negative controls: Generate CMTM6-knockout cell lines from both species to establish baseline measurements
Cross-reactivity validation: Thoroughly test antibodies and detection reagents against both species' proteins
Related family members: Include CMTM4 (which shows overlapping functions with CMTM6 ) to control for family-specific effects
Protein expression normalization: Ensure comparable expression levels when comparing functions across species
Cellular context controls: Test in matched cell types from both species to account for cell-specific effects
Recombinant protein standards: Include purified proteins of known concentration for quantitative comparisons
Vector controls: Use identical expression vectors with species-specific sequence variations
Environmental variables: Maintain identical experimental conditions (temperature, media, timing) across all comparative experiments
Multiple methodological approaches: Confirm findings using independent techniques
Dose-response relationships: Test across concentration ranges to identify potential differences in sensitivity
Time-course analyses: Evaluate kinetic differences that might not be apparent at single timepoints
| Control Type | Human Sample | Pongo abelii Sample | Purpose |
|---|---|---|---|
| Genetic | CMTM6 wildtype | CMTM6 wildtype | Baseline comparison |
| Genetic | CMTM6 knockout | CMTM6 knockout | Functional validation |
| Protein | Recombinant human CMTM6 | Recombinant Pongo abelii CMTM6 | Direct protein comparison |
| Family | CMTM4 expression | CMTM4 expression | Functional redundancy assessment |
| Technical | Vector only | Vector only | Expression system control |
These controls ensure that observed differences reflect true biological variation rather than technical artifacts or methodological inconsistencies.
When interpreting differences in CMTM6 function between human and Pongo abelii models, researchers should consider multiple factors:
Divergence timeline: Humans and orangutans diverged approximately 12-16 million years ago, allowing for functional adaptations
Selection pressures: Different pathogen exposures may have driven species-specific immune adaptations
Genomic context: Changes in interacting partners or regulatory networks might influence functional outcomes
Reagent cross-reactivity: Antibodies or detection systems may have different affinities for each species' proteins
Expression system artifacts: Heterologous expression might not recapitulate native conditions
Cellular context differences: The broader signaling environment might differ between species
Establish confidence in the observation: Confirm differences through multiple experimental approaches
Quantify the magnitude: Determine whether differences are substantial or subtle variations around similar functions
Localize the differences: Map variations to specific protein domains or activities
Consider functional consequences: Assess the biological significance of any observed differences
Develop testable explanations: Generate hypotheses about why the differences evolved
Clearly distinguish between directly observed differences and inferred functional implications
Acknowledge limitations in cross-species comparisons
Provide quantitative measures of difference when possible
Consider alternative explanations for observed variations
Contextualize findings within broader evolutionary patterns
Research with Pongo abelii models offers valuable opportunities to understand the evolution of immune regulation, but requires careful interpretation to avoid anthropomorphizing non-human systems or overlooking important species-specific adaptations.
Gene editing technologies offer powerful approaches to investigate CMTM6 function in Pongo abelii cells:
Complete knockout studies: Generate CMTM6-null Pongo abelii cells to assess effects on PD-L1 stability and immune response
Domain-specific mutations: Introduce targeted modifications to functional domains to assess their importance
Knock-in approaches: Tag endogenous CMTM6 with fluorescent proteins or affinity tags for visualization and purification
Promoter modification: Alter expression levels to study dose-dependent effects
Guide RNA design: Account for species-specific sequence variations when designing gRNAs
Off-target analysis: Thoroughly validate specificity in the Pongo abelii genome
Delivery methods: Optimize transfection or transduction protocols for orangutan cells
Clone selection: Use single-cell derivation to ensure genetic homogeneity
Complementation studies: Rescue phenotypes with wild-type or mutant CMTM6 to confirm specificity
Cross-species complementation: Test whether human CMTM6 can functionally replace the orangutan version
Dose-response relationships: Create cells with varying CMTM6 expression levels
Interaction partner screening: Identify species-specific CMTM6 binding partners using proximity labeling
Creating cellular models to study evolutionary conservation of CMTM6-PD-L1 regulation
Investigating species-specific differences in CMTM6's impact on immune evasion
Developing platforms for testing therapeutic strategies targeting CMTM6
Exploring PD-L1-independent functions through specific domain mutations
Research has already demonstrated that "ablation of CMTM6 significantly reduced human and murine tumor growth in a manner dependent on T-cell immunity" . Similar approaches in Pongo abelii cells could reveal whether this function is conserved across primates and provide insights into the evolutionary development of immune evasion mechanisms.
CMTM6 has emerged as a significant factor in cancer immunotherapy resistance through several mechanisms:
PD-L1 Stabilization: CMTM6 prevents PD-L1 degradation, enhancing the PD-1/PD-L1 immune checkpoint
Predictive Biomarker Potential: Studies show "CMTM6 was also found to be an independent predictor of the response to PD-1 inhibitors"
Beyond PD-L1: Evidence indicates CMTM6 suppression "broke resistance to immune-checkpoint inhibitors and remodeled the tumor immune microenvironment"
Tumor Progression Correlation: "CMTM6 expression increased with tumor progression in both patients and mice"
Evolutionary Insights: Comparing human and orangutan CMTM6 can reveal conserved mechanisms essential for immune evasion
Novel Target Identification:
Improved Animal Models: Findings from orangutan studies could inform more relevant preclinical models
Mechanism Elucidation: Cross-species comparison can help distinguish general from human-specific resistance mechanisms
Comparative binding studies: Assess differences in CMTM6-PD-L1 interaction strength
Domain mapping: Identify species-specific variations in functional domains
Response comparison: Measure differences in immune activation when CMTM6 is inhibited
Therapeutic testing: Evaluate whether anti-CMTM6 approaches effective in human models work similarly in orangutan cells
Studies have demonstrated that "CMTM6 depletion, via the reduction of PD-L1, significantly alleviates the suppression of tumor-specific T cell activity in vitro and in vivo" , suggesting that comparative studies could yield valuable insights into conserved mechanisms of immune evasion that might be more safely targeted in cancer therapy.
Purifying recombinant Pongo abelii CMTM6 requires specialized approaches due to its transmembrane nature:
Detergent selection: Mild non-ionic or zwitterionic detergents (DDM, CHAPS, or Digitonin) preserve native structure
Membrane preparation: Careful fractionation of cellular membranes before solubilization
Alternative approaches: Consider native nanodiscs or styrene-maleic acid copolymer lipid particles (SMALPs) for detergent-free extraction
Affinity chromatography: Primary capture based on fusion tags (His, GST, etc.)
Ion exchange chromatography: Secondary purification exploiting the protein's charge properties
Size exclusion chromatography: Final polishing step and buffer exchange
Specialized techniques: Lipid-based chromatography for maintaining membrane protein structure
Buffer optimization: Include glycerol (typically 50%) and appropriate detergent concentrations
Temperature control: Maintain 4°C throughout purification to minimize degradation
Protease inhibitors: Include complete protease inhibitor cocktails
Reducing agents: Maintain appropriate redox conditions for structural integrity
pH considerations: Optimize based on the protein's theoretical isoelectric point
Purity assessment: SDS-PAGE, Western blotting, and mass spectrometry
Functional validation: PD-L1 binding assays to confirm activity
Structural integrity: Circular dichroism or other spectroscopic methods
Aggregation monitoring: Dynamic light scattering or analytical size exclusion
Short-term storage: 4°C in optimized buffer with detergents
Long-term preservation: Aliquot and store at -80°C with cryoprotectants
Avoid repeated freeze-thaw cycles: "Repeated freezing and thawing is not recommended"
When working with recombinant Pongo abelii CMTM6, researchers should pay particular attention to maintaining the native membrane environment or suitable mimetics throughout purification to preserve functional activity.
Investigating the evolutionary conservation of CMTM6 function across primates requires a multi-disciplinary approach:
Multiple sequence alignment: Compare CMTM6 sequences across primate species to identify conserved domains
Phylogenetic reconstruction: Establish evolutionary relationships and divergence patterns
Selection pressure analysis: Calculate dN/dS ratios to identify regions under purifying or positive selection
Ancestral sequence reconstruction: Infer the sequence of CMTM6 in the common ancestor of humans and orangutans
Comparative modeling: Generate and compare 3D structure predictions of CMTM6 from different primates
Molecular dynamics simulations: Assess how sequence differences might affect protein dynamics
Binding site analysis: Identify and compare potential interaction surfaces for PD-L1 and other partners
Domain architecture comparison: Evaluate conservation of functional modules across species
Cross-species binding assays: Measure interaction strength between CMTM6 and PD-L1 from different primates
Chimeric protein studies: Create fusion proteins with domains from different species to map functional regions
Complementation experiments: Test whether CMTM6 from one species can restore function in cells from another species
Equivalent mutation effects: Determine if the same mutations have consistent effects across species
Comparative transcriptomics: Analyze expression patterns across tissues in different primates
Regulatory element comparison: Identify conserved and divergent promoter and enhancer regions
Single-cell expression profiling: Compare cell type-specific expression across species
These approaches can help distinguish universal features of CMTM6 function from species-specific adaptations, providing insights into both fundamental biology and potential therapeutic applications targeting conserved mechanisms.
Quantitative measurement of CMTM6's effect on PD-L1 stability in Pongo abelii cells requires rigorous methodological approaches:
Pulse-chase experiments: Label newly synthesized proteins with radioactive amino acids or click chemistry and track degradation over time
Cycloheximide chase assays: Block new protein synthesis and measure PD-L1 degradation rate with or without CMTM6
Time-course flow cytometry: Monitor surface PD-L1 levels after blocking transport from Golgi (Brefeldin A treatment)
Surface plasmon resonance (SPR): Determine binding kinetics and affinity between purified Pongo abelii CMTM6 and PD-L1
Microscale thermophoresis (MST): Measure interaction parameters in solution
Bio-layer interferometry (BLI): Analyze real-time binding interactions
Fluorescence recovery after photobleaching (FRAP): Measure membrane dynamics of fluorescently tagged PD-L1 with or without CMTM6
Förster resonance energy transfer (FRET): Quantify protein proximity in living cells
Single-molecule tracking: Follow individual PD-L1 molecules to assess diffusion rates and endocytic events
Ubiquitination assays: Compare PD-L1 ubiquitination levels in the presence or absence of CMTM6
Endosomal trafficking analysis: Track co-localization with endosomal markers using quantitative image analysis
Lysosomal degradation measurement: Assess PD-L1 accumulation after lysosomal inhibitor treatment
Use matched CMTM6 knockout and wildtype Pongo abelii cell lines
Create dose-responsive systems with tunable CMTM6 expression
Include both steady-state and dynamic measurements
Normalize to appropriate housekeeping controls
Perform parallel experiments with human cells for direct comparison
Research has shown that in human cells, "CMTM6 is not required for PD-L1 maturation but co-localizes with PD-L1 at the plasma membrane and in recycling endosomes, where it prevents PD-L1 from being targeted for lysosome-mediated degradation" . Quantitative approaches can determine whether this mechanism is conserved in Pongo abelii and identify any species-specific variations in efficiency or regulation.
Understanding differences in CMTM6 expression patterns between human and Pongo abelii tissues requires comprehensive comparative analysis:
Cross-species transcriptomics: Analyze RNA-seq data from matched tissues when available
Comparative immunohistochemistry: Use validated antibodies with confirmed cross-reactivity
Quantitative PCR: Measure expression levels with species-specific primers
In situ hybridization: Visualize expression patterns in tissue contexts
Single-cell RNA sequencing: Compare cell type-specific expression profiles
Tissue distribution: Variations in which tissues express the highest levels of CMTM6
Developmental timing: Differences in expression during various developmental stages
Response to stimuli: Divergent regulation in response to immune activation or stress
Splice variant predominance: Different isoforms may be expressed preferentially
Subcellular localization: Variations in protein distribution within cells
Differences in tissue expression could reflect evolutionary adaptations to specific immune challenges
Variations might contribute to differences in disease susceptibility between species
Expression pattern differences could affect the suitability of targeting CMTM6 therapeutically
While specific comparative data between human and Pongo abelii CMTM6 expression is limited, human CMTM6 is "ubiquitously expressed" and "widely expressed in many tissues" . The high conservation of the protein suggests similar broad expression in orangutans, though species-specific differences likely exist, particularly in immune-related tissues where evolutionary pressures may have driven divergent regulation.
CMTM6 exhibits significant interactions with multiple components of the immune checkpoint system beyond its well-established role in stabilizing PD-L1:
Multiple Immunoinhibitors: Research shows CMTM6 expression correlates with numerous immunoinhibitory molecules:
Immunostimulatory Molecules: Also shows significant correlation with stimulatory checkpoints:
PD-L1-Independent Functions: Evidence indicates CMTM6 has functions beyond PD-L1:
Immune Cell Expression: "CMTM6 was widely expressed on immune cells"
T Cell Intrinsic Functions: "T-cell CMTM6 levels increased with sustained immune activation and intratumoral immune exhaustion and affected T cell–intrinsic PD-L1 levels"
Extensive Chemokine Correlations: "CMTM6 was positively correlated with 26 chemokines such as CCL2-5, CXCL1-3, CXCL8-14 and 10 chemokine receptors such as CCR1, CCR2, CXCR1"
Family Relationship: CMTM6 belongs to a family with structural similarity to chemokines, suggesting potential functional overlap
These multiple interactions suggest CMTM6 may function as a broader immune regulatory hub rather than simply a PD-L1 stabilizer. Comparative studies between human and Pongo abelii could reveal which of these interactions are evolutionarily conserved and potentially fundamental to immune regulation versus those that might represent species-specific adaptations.
The finding that "host CMTM6 knockout significantly restrained tumor growth in a manner dependent on CD8+ T cells and not entirely dependent on PD-L1" highlights the importance of investigating these broader immune regulatory functions.
Rigorous quality control is crucial when validating antibodies against Pongo abelii CMTM6 to ensure specific and reliable detection:
Western blot analysis:
Immunoprecipitation followed by mass spectrometry: Confirm that the antibody specifically pulls down CMTM6
Peptide competition assays: Verify that specific peptides can block antibody binding
Species cross-reactivity testing: Determine binding to human CMTM6 and other primate CMTM6 proteins
Epitope mapping: Identify the specific binding site to assess conservation across species
ELISA-based quantification: Measure binding affinity to different species' CMTM6
Immunohistochemistry controls:
Use CMTM6-transfected and knockout cells as positive and negative controls
Compare staining patterns with mRNA expression data
Flow cytometry validation:
Test on cells with manipulated CMTM6 expression levels
Compare surface vs. permeabilized staining to confirm expected localization
Immunofluorescence specificity:
Co-localization with other markers of expected subcellular compartments
Signal absence in knockout cells
Lot-to-lot consistency: Test multiple antibody lots for consistent performance
Inter-laboratory validation: Confirm results across different research settings
Different sample preparations: Verify performance in fixed vs. frozen tissues, native vs. denatured proteins
Complete validation data should be recorded, including:
Positive and negative controls used
All testing conditions and protocols
Images of original blots or staining results
Quantitative measures of specificity and sensitivity
Any observed limitations or cross-reactivity
These quality control measures ensure that research findings based on antibody detection of Pongo abelii CMTM6 are reliable and reproducible, providing a solid foundation for comparative studies with human CMTM6.