Recombinant Pongo abelii Claudin-10 (CLDN10)

Shipped with Ice Packs
In Stock

Description

Functional and Biological Context

Claudin-10 is a critical component of tight junctions, which regulate ion and solute transport across epithelial layers. While Pongo abelii CLDN10 is not directly studied in functional assays, insights from related species highlight its potential roles:

  • Ion Selectivity: In mammals, CLDN10 isoforms (e.g., CLDN10a, CLDN10b) influence sodium, calcium, and magnesium permeability in renal tubules .

  • Tumor Suppression: In human clear cell renal carcinoma (ccRCC), CLDN10 overexpression suppresses metastasis by modulating mitochondrial dysfunction and epithelial-to-mesenchymal transition .

  • Mitochondrial Localization: Emerging evidence suggests claudins may localize to mitochondria, interacting with proteins like ATP5O to regulate acetylation and metabolic pathways .

Applications in Research

The recombinant Pongo abelii CLDN10 is primarily used as a tool for:

  1. Structural Studies: Detailed analysis of claudin folding, transmembrane domain interactions, and extracellular loop dynamics.

  2. Comparative Biology: Investigating evolutionary conservation of claudin functions across primates.

  3. Functional Assays: Validating interactions with tight junction partners (e.g., occludin, tricellulin) or ion transport mechanisms.

Research Challenges and Considerations

  • Species-Specific Differences: Functional studies on Pongo abelii CLDN10 may not directly translate to human or rodent models due to sequence divergence.

  • Post-Translational Modifications: His-tagged proteins may impact native folding or interactions; alternative tags (e.g., GST) are available for comparative studies .

  • Storage and Handling: Repeated freeze-thaw cycles degrade activity; aliquoting is essential .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will fulfill your requirement.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery estimates, please contact your local distributor.
Note: Our standard shipping includes normal blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For short-term storage (up to one week), store working aliquots at 4°C.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life for liquid form is 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type requirement, please let us know and we will prioritize its development.
Synonyms
CLDN10; Claudin-10
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-228
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
CLDN10
Target Protein Sequence
MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGV SNCKDFPSMLALDGYIQACRGLMIAAVSLGSFGSIFALFGMKCTKVGGSDKAKAKIACLA GIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFC FSISDNNKTPRYAYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV
Uniprot No.

Target Background

Function
Claudin-10 plays a crucial role in tight junction-specific obliteration of the intercellular space, achieved through calcium-independent cell-adhesion activity. It is involved in regulating paracellular epithelial permeability to ions in multiple organs. Claudin-10 acts as a paracellular ion channel, likely forming permselective pores. Isoform 1 appears to create pores preferentially permeable to cations, while isoform 2 is associated with anion permeability. In sweat glands and the thick ascending limb (TAL) of Henle's loop in the kidney, Claudin-10 controls paracellular sodium permeability, which is essential for proper sweat production and renal function.
Database Links
Protein Families
Claudin family
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.

Q&A

What expression systems and purification strategies are optimal for producing functional Recombinant Pongo abelii CLDN10?

Obtaining high-quality recombinant CLDN10 requires careful consideration of expression systems and purification strategies:

Expression Systems:

  • E. coli: Successfully used for Pongo abelii claudin domain-containing proteins , but may require refolding for membrane proteins

  • Wheat germ cell-free systems: Shown to produce functional human CLDN10 , providing better folding for complex proteins

  • Mammalian cells: Preferred for post-translational modifications and proper membrane insertion

Vector Design and Tags:

  • His-tag is commonly used for purification (as seen in Pongo abelii claudin domain-containing proteins)

  • Consider tag position (N or C-terminal) to minimize functional interference

  • Include appropriate cleavage sites if tag removal is desired

Purification Protocol:

  • Solubilization: Use mild detergents (e.g., n-dodecyl-β-D-maltoside) at optimized concentrations

  • Multi-step purification:

    • Initial affinity chromatography (His-trap or similar)

    • Secondary purification using ion exchange or size exclusion chromatography

    • Quality control via SDS-PAGE, Western blotting, and mass spectrometry

  • Storage: Maintain in appropriate buffer with 50% glycerol at -20°C/-80°C to prevent freeze-thaw damage

Functional validation should include binding assays or reconstitution into artificial membranes for electrophysiological studies.

What experimental approaches should be used to characterize the isoform-specific functions of Pongo abelii CLDN10?

Based on research with claudin-10 from other species, CLDN10 isoforms demonstrate distinct ion selectivity properties that require specific characterization approaches:

Isoform Identification and Expression Analysis:

  • Design isoform-specific PCR primers targeting the alternative first exons (1a or 1b)

  • Perform quantitative PCR across tissues to map expression patterns (kidney cortex shows higher claudin-10a, while medulla expresses more claudin-10b)

  • Use in situ hybridization to precisely localize isoform expression

Functional Characterization Methodologies:

  • Electrophysiological approaches:

    • Measure transepithelial resistance (TER) in transfected cell lines

    • Apply diffusion potential measurements using varying ion gradients

    • Calculate permeability ratios using the Goldman-Hodgkin-Katz equation

    • Test specific ion selectivity (Na+/Cl-, Mg2+, Ca2+, Li+)

  • Cell model systems:

    • Express each isoform in low-resistance epithelial cell lines like MDCK II or LLC-PK1

    • Measure paracellular permeability using fluorescent tracers

    • Examine co-localization with other tight junction proteins

Comparative Analysis Table:

PropertyClaudin-10aClaudin-10b
Primary expressionKidney cortex (proximal tubule)Kidney medulla (thick ascending limb)
Ion selectivityAnion-selective (Cl-)Cation-selective (Na+)
Effect on TERDecreases TERDecreases TER
Relative expressionKidney-specificWidely expressed across tissues
ECS1 charge propertiesSeven positive, one negative amino acidFour positive, five negative amino acids

These approaches would determine whether Pongo abelii CLDN10 isoforms show similar functional specialization as their human counterparts.

How can researchers effectively evaluate the paracellular ion selectivity of Recombinant Pongo abelii CLDN10?

To rigorously characterize the paracellular ion transport properties of Pongo abelii CLDN10:

Cell-Based Transport Assays:

  • Establish stable cell lines expressing Pongo abelii CLDN10 in epithelial cells with low endogenous claudin expression

  • Measure transepithelial electrical resistance (TER) using epithelial volt-ohm meters

  • Apply bi-ionic potential measurements using solutions with different ionic compositions

  • Calculate permeability ratios for various ions according to these formulas:

    • For monovalent ions (e.g., Na+/Cl-): Apply the Goldman-Hodgkin-Katz equation

    • For divalent/monovalent comparisons: Use appropriate corrections for charge differences

Electrophysiological Analysis Protocol:

  • Grow transfected cells on permeable supports to form tight monolayers

  • Mount in Ussing chambers for electrophysiological measurements

  • Apply defined ion gradients across the epithelium

  • Measure resulting diffusion potentials

  • Calculate ion permeability ratios and absolute permeabilities

Based on studies with claudin-10 from other species, researchers should prepare the following solutions for comprehensive ion selectivity characterization:

  • NaCl control solution

  • Na-pyruvate solution

  • Low Na-pyruvate solution

  • High Mg-pyruvate solution

  • High Ca-pyruvate solution

Distinguishing Isoform-Specific Properties:

When working with specific isoforms, expect claudin-10a to create anion-selective pores with P(Cl-)/P(Na+) > 1, while claudin-10b forms cation-selective channels with P(Na+)/P(Cl-) > 1 .

What experimental methods are most appropriate for studying the protein-protein interactions of Pongo abelii CLDN10?

Tight junctions are multiprotein complexes, and understanding CLDN10's interactions is critical for elucidating its function:

Direct Interaction Analysis:

  • Co-immunoprecipitation: Express tagged Pongo abelii CLDN10 in epithelial cells and identify interacting partners

  • Crosslinking approaches: Stabilize transient interactions followed by mass spectrometry identification

  • Surface plasmon resonance: Measure binding kinetics between purified proteins

Homophilic and Heterophilic Interaction Characterization:

  • Cis-interaction analysis (within same membrane):

    • Apply FRET to analyze oligomerization properties

    • Use chemical crosslinking followed by electrophoresis to identify oligomeric states

    • Implement blue native PAGE to preserve native complexes

  • Trans-interaction assessment (between opposing membranes):

    • Use contact enrichment assays to detect homophilic interactions

    • Express CLDN10 in HEK293 cells (typically lacking tight junctions) and assess cellular aggregation

    • Quantify enrichment at cell-cell contacts using fluorescence microscopy

Strand Formation Visualization:

  • Apply freeze-fracture electron microscopy to analyze tight junction strand morphology

  • Compare properties with those reported for claudin-10 mutations, which show "few particle-typed TJ strands with less compact meshworks"

Expected Interaction Partners:

Based on studies of claudin-10 in other species, researchers should investigate interactions with:

  • Other claudins (particularly claudin-2 in proximal tubule contexts)

  • Tight junction scaffolding proteins (ZO-1, ZO-2)

  • Regulatory kinases that may modify CLDN10 function

Research on claudin-10 mutations shows that altered interactions can significantly impact strand formation and barrier properties .

What methodological approaches should be used to study the impact of mutations in Pongo abelii CLDN10?

Mutations in human CLDN10 cause HELIX syndrome (hypohydrosis, electrolyte imbalance, lacrimal gland dysfunction, ichthyosis, and xerostomia) . To study equivalent mutations in Pongo abelii CLDN10:

Mutation Design and Expression:

  • Create expression constructs with mutations corresponding to known human disease variants

  • Express wildtype and mutant proteins in appropriate epithelial cell models

  • Verify expression levels and membrane localization using confocal microscopy

Functional Characterization:

  • Barrier function assessment:

    • Measure transepithelial resistance (TER)

    • Analyze paracellular flux of size-selective tracers

    • Determine ion selectivity changes using bi-ionic potential measurements

  • Protein-protein interaction analysis:

    • Assess homophilic interactions using contact enrichment assays

    • Measure trans-interaction capacity as described for human CLDN10 mutations

    • Quantify cis-interaction using FRET-based approaches

  • Strand formation evaluation:

    • Apply freeze-fracture electron microscopy to visualize tight junction strand architecture

    • Compare strand density, continuity, and morphology between wildtype and mutant proteins

Documented Human CLDN10 Mutations and Their Effects:

MutationAffected IsoformFunctional EffectDisease Association
P147R/P149RBoth isoformsPartial/complete loss of functionHELIX syndrome
D73NClaudin-10bPartial loss of functionHELIX syndrome
N48KClaudin-10bDisrupted trans-interactionHELIX syndrome
S129L/S131LBoth isoformsComplete loss of functionHELIX syndrome
M1TClaudin-10bComplete loss of functionHELIX syndrome
R78G/R80GBoth isoformsNot fully characterizedHELIX syndrome

Data compiled from

These approaches would provide valuable insights into structure-function relationships and disease mechanisms.

What techniques should be utilized to analyze the expression and localization patterns of Pongo abelii CLDN10 in tissues?

Understanding the tissue-specific expression and subcellular localization of CLDN10 is crucial for interpreting its function:

Expression Analysis Methods:

  • Quantitative PCR:

    • Design primers specific to Pongo abelii CLDN10 isoforms

    • Analyze expression across multiple tissues

    • Compare with known patterns (claudin-10a primarily in kidney, claudin-10b more widely distributed)

  • In situ hybridization:

    • Develop isoform-specific RNA probes

    • Apply to tissue sections to visualize expression patterns

    • Compare with known distribution (claudin-10a concentrated in cortex, claudin-10b in medulla)

  • RNA-Seq analysis:

    • Extract RNA from isolated nephron segments

    • Perform transcriptomic analysis to quantify CLDN10 isoform expression

    • Use bioinformatic approaches to identify co-expressed genes

Protein Localization Techniques:

  • Immunofluorescence microscopy:

    • Use validated antibodies that recognize Pongo abelii CLDN10

    • Co-stain with markers of specific nephron segments

    • Apply confocal or super-resolution microscopy for detailed localization

  • Immunoelectron microscopy:

    • Precisely localize CLDN10 within tight junction strands

    • Quantify gold particle distribution to assess relative abundance

    • Compare with other tight junction proteins

Expected Expression Pattern:

Based on studies in other species, expect claudin-10 to be distributed throughout the nephron with:

  • Claudin-10a predominantly in proximal tubule

  • Claudin-10b in thick ascending limb

  • Co-expression with claudin-2 in proximal tubule

  • Co-expression with claudin-16 and claudin-19 in thick ascending limb

This expression analysis provides essential context for functional studies.

How can researchers effectively study the role of Pongo abelii CLDN10 in blood-brain barrier function?

Recent research has identified claudin-10 as an important component of the blood-brain barrier . To investigate Pongo abelii CLDN10's role:

Experimental Model Systems:

  • Brain endothelial cell culture:

    • Express Pongo abelii CLDN10 in brain endothelial cell lines (e.g., hCMEC/D3)

    • Create knockdown models using siRNA or CRISPR

    • Measure barrier function using TEER and permeability assays

  • Co-culture systems:

    • Develop more complex models incorporating astrocytes and pericytes

    • Evaluate the influence of these cells on CLDN10 expression and function

    • Assess barrier properties in the presence of inflammatory stimuli

Functional Characterization:

  • Barrier integrity assessment:

    • Measure transendothelial electrical resistance (TEER)

    • Quantify paracellular permeability using fluorescent tracers

    • Assess response to barrier disruptors

  • Drug permeability studies:

    • Evaluate how CLDN10 affects drug delivery across the barrier

    • Compare transport of compounds with different physicochemical properties

    • Assess potential as a therapeutic target to enhance drug delivery

Based on research findings, expect that:

  • CLDN10 knockdown will reduce barrier integrity as measured by TEER

  • Paracellular permeability will increase with reduced CLDN10 expression

  • Cancer cell transmigration may be enhanced in CLDN10-deficient models

Clinical Relevance Assessment:

Investigate how CLDN10 might influence:

  • Drug delivery to the brain

  • Cancer cell invasion in brain metastasis

  • Response to neuroinflammatory conditions

This research direction has significant implications for understanding blood-brain barrier regulation and developing strategies for brain-targeted therapeutics.

What methods are most appropriate for investigating the structural characteristics of Pongo abelii CLDN10?

Understanding the structural properties of CLDN10 is essential for interpreting its function:

Computational Structure Analysis:

  • Homology modeling:

    • Use known claudin crystal structures as templates

    • Apply specialized membrane protein modeling approaches

    • Validate models using experimental data

  • Advanced prediction tools:

    • Implement AlphaFold or similar algorithms to predict structure

    • Analyze the transmembrane domains and extracellular loops

    • Predict potential interaction surfaces

Experimental Structural Characterization:

  • Circular dichroism spectroscopy:

    • Analyze secondary structure content of purified protein

    • Assess structural changes upon interaction with lipid vesicles

    • Compare with CD profiles of other claudins

  • Limited proteolysis:

    • Identify exposed regions versus protected domains

    • Map structural domains based on digestion patterns

    • Compare wildtype and mutant proteins

  • Crosslinking coupled with mass spectrometry:

    • Identify residues in close proximity

    • Map intramolecular contacts to validate structural models

    • Determine intermolecular contacts in oligomeric assemblies

Functional Structure Elements:

Based on claudin-10 research, key structural features to analyze include:

  • First extracellular domain (ECS1): Determines ion selectivity

  • Second extracellular domain (ECS2): Involved in trans-interactions

  • Transmembrane domains: Essential for membrane integration

  • C-terminal domain: Contains PDZ-binding motif for scaffolding interactions

Understanding these structural elements will provide insights into how CLDN10 forms paracellular channels with specific ion selectivity properties.

What experimental approaches should be used to study the regulation of Pongo abelii CLDN10 expression and function?

Understanding regulatory mechanisms is crucial for interpreting CLDN10's physiological roles:

Transcriptional Regulation Analysis:

  • Promoter characterization:

    • Identify and clone the promoter regions for Pongo abelii CLDN10 isoforms

    • Use reporter assays to measure promoter activity under different conditions

    • Identify transcription factor binding sites through bioinformatic analysis

  • Epigenetic regulation:

    • Analyze DNA methylation patterns at promoter regions

    • Investigate histone modifications associated with active/inactive states

    • Apply ChIP-seq to identify transcription factors binding to promoters

Post-transcriptional Regulation:

  • Alternative splicing analysis:

    • Investigate mechanisms controlling isoform-specific expression

    • Identify splicing factors that regulate CLDN10 isoform generation

    • Analyze splicing patterns across different tissues and conditions

Post-translational Modifications:

  • Phosphorylation analysis:

    • Identify kinases and phosphatases that regulate CLDN10

    • Use phosphosite-specific antibodies to monitor phosphorylation status

    • Apply mass spectrometry to map modification sites

  • Palmitoylation studies:

    • Investigate the role of palmitoylation in membrane targeting

    • Use site-directed mutagenesis to eliminate palmitoylation sites

    • Assess functional consequences of preventing palmitoylation

Trafficking and Turnover:

  • Membrane targeting analysis:

    • Use fluorescently tagged CLDN10 to track intracellular movement

    • Apply photoactivatable constructs to monitor trafficking kinetics

    • Identify motifs required for proper tight junction localization

  • Protein stability assessment:

    • Measure protein half-life under different conditions

    • Investigate ubiquitination and degradation pathways

    • Determine factors that regulate protein turnover

These approaches will elucidate how Pongo abelii CLDN10 expression and function are regulated in different physiological and pathological contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.