Recombinant Pongo abelii Claudin-11 (CLDN11)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pongo abelii Claudin-11 (CLDN11)

Recombinant Pongo abelii Claudin-11 (CLDN11) is a protein derived from the Sumatran orangutan, Pongo abelii. Claudin-11 is a member of the claudin family, which plays a crucial role in forming tight junctions in cells. These junctions are essential for maintaining cellular integrity and controlling the passage of ions and molecules across epithelial and endothelial layers. The recombinant form of this protein is produced through genetic engineering techniques, typically in bacterial systems like Escherichia coli (E. coli), to facilitate its study and application in various scientific and medical contexts.

Expression and Purification

Recombinant Pongo abelii Claudin-11 is expressed in E. coli and purified to a high degree, typically greater than 90% as determined by SDS-PAGE . This protein is often fused with a His-tag at the N-terminal to facilitate purification using nickel affinity chromatography.

Protein Structure and Sequence

The full-length protein consists of 200 amino acids (1-200aa) and has a specific amino acid sequence: MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMATGLYHCKPLVDILPCRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRAQLAGVLLILLALCAIVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGENRFYYTAGSSSPTHAKSAHV .

Biological Functions of Claudin-11

Claudin-11 is known for its role in myelination, auditory function, and spermatogenesis. In the central nervous system (CNS), it is the sole claudin family member expressed in myelin, making it indispensable for maintaining the integrity and function of the myelin sheath . Claudin-11 also plays a role in oligodendrocyte migration and proliferation, which are crucial for myelin formation and repair .

Myelin Disorders

Recent studies have linked mutations in the CLDN11 gene to hypomyelinating leukodystrophy (HLD22), highlighting the importance of claudin-11 in myelin maintenance . Understanding its role can help in developing targeted therapies for such disorders.

Cancer Research

Claudin-11 has been implicated in cancer, with varying effects depending on the type of cancer. In some cancers, reduced expression of claudin-11 may enhance cell migration, while in others, its upregulation may facilitate cancer cell dissemination .

Comparison with Other Claudin-11 Proteins

CharacteristicsRecombinant Pongo abelii Claudin-11Recombinant Human Claudin-11
SpeciesPongo abelii (Sumatran orangutan)Homo sapiens (Human)
Expression SystemE. coliE. coli
Protein Length1-200aa1-207aa
TagHis-tagHis-tag
Purity>90%>90%
Storage-20°C/-80°C-20°C/-80°C

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For specific delivery timeframes, please contact your local distributors.
Note: Our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please inform us in advance. Additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein with deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquotting for long-term storage at -20°C/-80°C. Our default glycerol final concentration is 50%, which can serve as a reference for your own protocols.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of the liquid form is 6 months at -20°C/-80°C. The shelf life of the lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple use to minimize freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have specific tag type requirements, please inform us, and we will prioritize developing the specified tag.
Synonyms
CLDN11; Claudin-11
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-200
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
CLDN11
Target Protein Sequence
MVATCLQVVGFVTSFVGWIGVIVTTSTNDWVVTCGYTIPTCRKLDELGSKGLWADCVMAT GLYHCKPLVDILPCRALMIAASVLGLPAILLLLTVLPCIRMGQEPGVAKYRRAQLAGVLL ILLALCAIVATIWFPVCAHRETTIVSFGYSLYAGWIGAVLCLVGGCVILCCAGDAQAFGE NRFYYTAGSSSPTHAKSAHV
Uniprot No.

Target Background

Function
Claudin-11 plays a crucial role in tight junction-specific obliteration of the intercellular space. This function is mediated by calcium-independent cell-adhesion activity.
Database Links
Protein Families
Claudin family
Subcellular Location
Cell junction, tight junction. Cell membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Pongo abelii CLDN11 and how does it compare to human CLDN11?

Pongo abelii CLDN11 is a tetraspan membrane protein belonging to the claudin family of tight junction proteins. While specific structural data for Pongo abelii CLDN11 is limited, research on human CLDN11 indicates it is a 207 amino acid multipass membrane protein . Based on evolutionary conservation patterns among primates, Pongo abelii CLDN11 likely shares significant homology with human CLDN11, which itself shares 94% amino acid sequence identity with mouse and rat Claudin-11 . Researchers should note that comparative genomics studies of claudins across species demonstrate high conservation of functional domains while allowing for species-specific variations that may affect binding affinities and interaction profiles.

How does CLDN11 contribute to tight junction formation and barrier function?

CLDN11 is a critical structural component of tight junctions, forming paracellular barriers that regulate molecular transport between cells. Studies indicate that CLDN11 creates tissue-specific barriers, particularly in specialized epithelia. The protein contains extracellular loops that interact with complementary domains on adjacent cells to form the tight junction seal . These interactions are stabilized by intracellular domains that anchor to the cytoskeleton.

In functional studies, CLDN11 has been shown to regulate epithelial remodeling during spermatogenesis and contributes to inner ear mechanotransduction . Knockout experiments in developmental models demonstrate that CLDN11 deficiency leads to abnormal development of ear placodes and pharyngeal arches, indicating its crucial role in morphogenesis of vertebrate-specific traits .

What expression systems are optimal for producing functional recombinant Pongo abelii CLDN11?

For recombinant CLDN11 expression, mammalian cell systems are generally preferred over bacterial systems to ensure proper post-translational modifications and membrane insertion. Based on established protocols for claudin proteins:

Expression SystemAdvantagesLimitationsYield (mg/L culture)
HEK293 cellsNative folding, PTMsSlower growth1-5
CHO cellsScalable, stable linesClone selection time2-10
Insect cellsHigher yieldDifferent glycosylation5-15
E. coli (inclusion bodies)Highest yieldRefolding required10-50

Researchers should implement codon optimization for Pongo abelii preference and include a cleavable purification tag that minimally interferes with protein folding. C-terminal tags are typically preferred as N-terminal modifications may disrupt signal peptide processing.

What analytical methods should be employed to verify proper folding and functionality of recombinant CLDN11?

A multi-faceted approach is recommended:

  • Structural integrity assessment: Circular dichroism spectroscopy to verify secondary structure composition, particularly the alpha-helical content characteristic of transmembrane domains.

  • Functional validation: Transepithelial/transendothelial electrical resistance (TEER) measurements in cell monolayers expressing the recombinant protein compared to controls.

  • Interaction validation: Co-immunoprecipitation or proximity ligation assays to confirm interactions with known binding partners of CLDN11.

  • Localization studies: Immunofluorescence microscopy using Alexa Fluor® 647-conjugated antibodies (similar to those developed for human CLDN11) to verify membrane localization and clustering at cell-cell contacts .

How does CLDN11 participate in cell signaling pathways beyond its structural role?

Recent research has revealed that CLDN11 functions beyond its classical barrier-forming role. Studies indicate bidirectional signaling capabilities:

  • EphB4-mediated signaling: CLDN11 regulates bone homeostasis through bidirectional EphB4 signaling pathways, affecting osteoblast-osteoclast balance .

  • Cancer progression signaling: CLDN11 has been identified as a key factor in promoting gastric cancer metastasis, particularly to lymph nodes . This involves altered cell-cell adhesion and potentially EMT (epithelial-mesenchymal transition) pathway activation.

  • Developmental signaling: Knockout experiments demonstrate CLDN11's involvement in morphogenetic signaling during ear placode and pharyngeal arch development .

Researchers investigating Pongo abelii CLDN11 should design experiments that can distinguish between direct structural effects and secondary signaling consequences when disrupting CLDN11 function.

What is the role of CLDN11 in cancer metastasis and how can this be experimentally evaluated?

CLDN11 has been identified as a key driving factor in lymph node metastasis, particularly in gastric cancer models . Differential gene expression analysis between primary and metastatic lesions showed significant upregulation of CLDN11 in metastatic tissues .

To investigate this function experimentally:

  • Transwell migration assays: Cell invasion and migration can be assessed after CLDN11 overexpression or knockdown .

  • Correlation analysis: Evaluate correlation between CLDN11 expression and immune cell infiltration, particularly B cells and CD4+ T cells which show increased proportion in metastatic lesions with high CLDN11 expression .

  • In vivo metastasis models: Orthotopic xenograft models with CLDN11-modulated cancer cells allow tracking of metastatic potential.

  • RNA-seq and pathway analysis: Identify downstream effectors by comparing transcriptomes of CLDN11-high versus CLDN11-low expressing cells .

Data indicates that CLDN11 expression is significantly higher in metastatic lesions compared to primary tumors, suggesting its utility as a potential biomarker for metastatic progression .

How can CLDN11 knockout models inform our understanding of vertebrate-specific trait evolution?

Claudin family expansion correlates with the evolution of vertebrate-specific traits. Research in lamprey models demonstrates that claudin homologs (particularly Claudin 3B, a homolog to CLDN3 in higher vertebrates) are involved in the development of vertebrate-specific traits like ear placodes .

For CLDN11 research:

  • Comparative expression analysis: Map expression patterns of CLDN11 across species, focusing on vertebrate-specific structures.

  • CRISPR-Cas9 knockout studies: Generate tissue-specific or conditional knockouts to assess developmental consequences.

  • Rescue experiments: Test functional conservation by complementing knockouts with orthologs from different species, including Pongo abelii CLDN11.

Knockout experiments have shown that claudin deficiency affects ear placode and pharyngeal arch development, with specific effects depending on the claudin variant. In one study, Claudin 3B knockout resulted in abnormal ear placode development in 50-70% of embryos .

What techniques are most effective for studying CLDN11 expression patterns during development?

Based on established methodologies in claudin research:

  • Whole-mount in situ hybridization: This technique effectively visualizes spatial expression patterns of CLDN11 in intact embryos .

  • RNA-Seq with single-cell resolution: Provides quantitative expression data across developmental stages and cell types.

  • Reporter gene constructs: Creating CLDN11 promoter-reporter fusions allows real-time monitoring of expression in live embryos.

  • Immunohistochemistry: Using specific antibodies against CLDN11 enables protein-level localization studies.

For accurate results, researchers should design probes targeting unique UTRs of CLDN11 to avoid cross-reactivity with other claudin family members. Studies have successfully used this approach to distinguish expression patterns of closely related claudins .

How can post-translational modifications of CLDN11 be systematically characterized?

Post-translational modifications (PTMs) can significantly alter CLDN11 function and localization. A comprehensive PTM characterization workflow should include:

  • Mass spectrometry analysis: Employing high-resolution LC-MS/MS with enrichment strategies for specific modifications (phosphorylation, glycosylation, palmitoylation).

  • Site-directed mutagenesis: Systematically mutating predicted modification sites to evaluate functional consequences.

  • Modification-specific antibodies: Developing antibodies that recognize specific PTM states of CLDN11.

  • In silico prediction: Utilizing algorithms that predict PTM sites based on consensus sequences and structural accessibility.

Expected PTMs may include phosphorylation of cytoplasmic domains affecting protein-protein interactions, palmitoylation influencing membrane association, and potentially glycosylation affecting extracellular domain interactions.

What are the current limitations in studying protein-protein interactions of membrane-integrated CLDN11?

Investigating membrane protein interactions presents unique challenges:

  • Detergent solubilization effects: Detergents required for membrane protein extraction can disrupt native interactions. Researchers should employ nanodisc technology or styrene-maleic acid copolymer (SMA) approaches to maintain the native lipid environment.

  • Transient interaction capture: Many claudin interactions are transient or dependent on specific membrane microdomains. Techniques like cross-linking mass spectrometry (XL-MS) or proximity labeling (BioID, APEX) can capture these ephemeral interactions.

  • Reconstitution challenges: In vitro reconstitution of functional tight junction complexes requires specific lipid compositions and claudin densities. Researchers should consider high-throughput screening of lipid compositions to optimize reconstitution conditions.

  • Heterologous expression artifacts: Overexpression in model systems may lead to non-physiological interactions. CRISPR knock-in approaches maintaining endogenous expression levels are recommended for validation studies.

How might CLDN11-targeted approaches be developed for bone-related disorders?

Research indicates that CLDN11 regulates bone homeostasis via bidirectional EphB4 signaling , suggesting potential therapeutic applications for osteoporosis and other bone disorders. Development strategies should consider:

  • Pathway-specific modulation: Target specific aspects of CLDN11-EphB4 signaling rather than complete CLDN11 inhibition to avoid off-target effects.

  • Tissue-specific delivery: Develop bone-targeting delivery systems for CLDN11 modulators to minimize systemic effects.

  • Combination approaches: Consider CLDN11-targeted therapies as adjuncts to existing anti-resorptive or anabolic osteoporosis treatments.

  • Biomarker development: Investigate circulating CLDN11 or associated factors as potential diagnostic or prognostic markers for bone disorders.

Researchers should note that while CLDN11 provides a promising target, comprehensive pre-clinical validation is required to address potential side effects on other CLDN11-expressing tissues like CNS myelin and testis.

What experimental approaches can evaluate CLDN11's role in maintaining blood-tissue barriers?

CLDN11 contributes to specialized barriers in multiple tissues. To evaluate its barrier function:

  • Permeability assays: Employ size-selective tracers and electrical resistance measurements (TEER) in cell models with modulated CLDN11 expression.

  • Ex vivo barrier integrity: Utilize Ussing chamber techniques with tissue explants to measure paracellular flux of ions and molecules.

  • In vivo barrier assessment: Develop conditional knockout models with tissue-specific CLDN11 deletion to assess barrier integrity in living systems.

  • Freeze-fracture electron microscopy: Visualize tight junction strand organization and complexity as affected by CLDN11 status.

  • Claudin mimetic peptides: Design peptides mimicking the extracellular loops of CLDN11 to competitively disrupt homotypic interactions and assess functional consequences.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.