Recombinant Pongo abelii Claudin-12 (CLDN12)

What is the gene structure of CLDN12 in Pongo abelii?

CLDN12 (claudin-12) in Pongo abelii (Sumatran orangutan) is a protein-coding gene with specific accession numbers NM_001133960.1 (for mRNA) and NP_001127432.1 (for protein). The open reading frame (ORF) sequence is 735bp in length, encoding the full claudin-12 protein . Additionally, there are variant isoforms such as claudin-12 isoform X1 (accession XM_009243034.1 for mRNA and XP_009241309.1 for protein) . The full gene has been sequenced and is available in reference databases, though it should be noted that NCBI classifies some sequences as "PROVISIONAL REFSEQ" pending final review .

How should recombinant CLDN12 protein be stored and handled in laboratory settings?

For optimal stability and activity of recombinant Pongo abelii CLDN12 protein, storage at -20°C is recommended for regular use, while -80°C is preferred for extended storage . Working aliquots can be maintained at 4°C for up to one week . Importantly, repeated freeze-thaw cycles should be avoided as they may compromise protein integrity and functional activity . The protein is typically supplied in a Tris-based buffer with 50% glycerol that has been optimized for stability . When designing experiments, researchers should factor in thawing time and avoid unnecessary temperature fluctuations.

What experimental systems are commonly used to study CLDN12 function?

Several experimental systems have been established to study CLDN12 function:

• Cell culture models: Human cell lines (A549, LS180, HeLa) with differential CLDN12 expression are widely used for in vitro studies . Selection of appropriate cell lines should be based on endogenous CLDN12 expression levels.

• Animal models: Targeted gene deletion approaches have been successfully employed, such as mice with targeted deletion of exon2 in the Cldn12 gene . These knockout models allow for assessment of physiological roles of CLDN12 in vivo.

• Migration assays: Transwell chambers with 8.0 μm pore polycarbonate membranes are utilized to assess the role of CLDN12 in cell migration, with experimental protocols typically including treatment with anti-CLDN12 antibodies (1 μg/mL) .

• Viability and cytotoxicity assays: MTT assays following treatment with anti-CLDN12 antibodies or synthetic peptides representing CLDN12 extracellular loops .

What detection methods are available for CLDN12 expression analysis?

Multiple techniques have been validated for CLDN12 detection:

• Immunohistochemistry (IHC): This method allows for semi-quantitative assessment of CLDN12 expression in tissue samples, combining scores for percentage of positively stained cells and staining intensity . IHC can effectively detect CLDN12 in specific cell types within complex tissues.

• Immunofluorescence microscopy: Utilizing anti-CLDN12 primary antibodies followed by fluorescently-labeled secondary antibodies (e.g., FITC-conjugated) enables visualization of CLDN12 subcellular localization .

• Western blotting: This technique provides quantitative analysis of CLDN12 protein expression levels and can be used to compare expression between different tissue or cell types .

• Flow cytometry: When combined with appropriate cell surface markers or apoptosis indicators (like Annexin V-FITC and propidium iodide), flow cytometry can assess cellular responses to CLDN12 manipulation .

How does CLDN12 contribute to epithelial-mesenchymal transition (EMT) and cancer metastasis?

CLDN12 has been identified as a significant factor in promoting epithelial-mesenchymal transition (EMT), particularly in lung squamous cell carcinoma (SqCC) . The mechanistic pathway appears to involve the Tyrosine kinase 2 (Tyk2)/Signal transducer and activator of transcription 1 (Stat1) signaling cascade .

Studies have demonstrated that CLDN12 expression is significantly upregulated in SqCC tissues compared to normal bronchial epithelial cells, and this elevated expression correlates with the extent of lymphatic metastasis in SqCC patients . Functionally, CLDN12 promotes the malignant transformation of human bronchial epithelial cells in vitro, enhancing their migration and invasive capabilities .

To experimentally investigate this relationship, researchers have employed:

• RNA interference techniques targeting Tyk2 to elucidate the downstream signaling effects

• Migration and wound-healing assays to quantify the impact of CLDN12 on cell motility

• Immunofluorescence detection of EMT markers following CLDN12 manipulation

• Western blot analysis of EMT-associated proteins to confirm phenotypic shifts

The association between CLDN12 expression patterns and clinical outcomes suggests potential utility as a prognostic biomarker, with patient follow-up studies extending to 60 months to correlate expression levels with survival outcomes .

What approaches can be used to generate and validate CLDN12 knockout models?

The generation of CLDN12 knockout models involves strategic targeting of critical gene regions. One validated approach is the targeted deletion of exon2 in the Cldn12 gene, which has been successfully implemented in mouse models . When developing such models, researchers should consider:

• Target selection: Exonic regions critical for protein function should be prioritized to ensure complete functional knockout.

• Phenotype validation: Comprehensive phenotypic analysis including micro-CT analysis of bone parameters may reveal tissue-specific effects. For example, Cldn12 knockout mice show a 47% increase in articular cartilage area at the knee compared to control littermates, despite showing no significant differences in cortical or trabecular bone parameters .

• Expression confirmation: Immunohistochemistry should be performed to confirm the absence of CLDN12 expression in knockout models and to characterize expression patterns in control animals. Studies have shown that CLDN12 expression patterns change with development - from expression in both differentiating chondrocytes and osteoblasts in young mice to restricted expression in differentiating chondrocytes of the articular cartilage and growth plate in adult mice .

• Functional assays: Tissue-specific analyses based on expression patterns should be conducted. For CLDN12, articular cartilage assessment has proven particularly informative, revealing significant phenotypic differences that were not apparent in other tissues .

How can synthetic peptides based on CLDN12 structure be designed for functional studies?

Synthetic peptides representing specific domains of CLDN12, particularly the extracellular loops, provide valuable tools for mechanistic studies. When designing these peptides:

• Domain selection: Focus on the extracellular loops of CLDN12, as these regions mediate intercellular interactions and are accessible targets for experimental manipulation .

• Peptide length optimization: Synthesize peptides (designated p1-p6) representing different segments of the extracellular loops, typically ranging from 15-25 amino acids in length for optimal specificity and solubility .

• Concentration determination: Experimental testing has established 5 μg/mL as an effective concentration for most functional assays, though dose-response studies should be conducted for each experimental system .

• Functional validation: Compare effects with monoclonal anti-CLDN12 antibodies (typically used at 1 μg/mL) in parallel experiments to confirm domain-specific functions .

• Sequence conservation analysis: When designing peptides based on Pongo abelii CLDN12, consider sequence conservation across species, particularly for studies with translational implications. The complete amino acid sequence (MGCRDVHAATVLSFLCGIASVAGLFAGTLLPNWRKLRLITFNRNEKNLTVYTGLWVKCARYSDGSSDCLMYDTTWYSSVDQLDLRVLQFALPLSMLLIAMGALLCLCLGMCNTAFRSSAGCHLVAGLLFFLAGTVSLSPSIWVIFYNIHLNKKFEPVFSFDYAVYVTIASAGGLFMTSLILFIWYCTCKSLPSPFWQPLYSHPPSMHTYSQPYSARSRLSAIEIDIPVVSHTT) provides the foundation for such designs .

What are the tissue-specific expression patterns of CLDN12 and how do they influence experimental design?

CLDN12 exhibits distinct tissue-specific and developmental expression patterns that significantly impact experimental design considerations: