Recombinant Pongo abelii Coiled-coil domain-containing protein 56 (CCDC56)

Shipped with Ice Packs
In Stock

Description

Functional Role in Mitochondrial Biology

CCDC56 is a conserved assembly factor for COX, a hetero-oligomeric enzyme composed of mitochondrial and nuclear-encoded subunits . In Drosophila melanogaster, CCDC56 knockout results in:

  • COX Deficiency: Reduced COX activity and subunit stability.

  • Developmental Arrest: Lethality due to impaired mitochondrial function .

  • Conserved Function: Human CCDC56 shares 42% amino acid identity with the fly homolog, suggesting analogous roles in COX biogenesis .

Mechanistic Insights
CCDC56 likely facilitates interactions between COX subunits or chaperones during assembly. Its coiled-coil domain may mediate structural organization of the COX complex, akin to the tetramer-forming coiled-coil domains observed in TRIM56 E3 ligases .

Research Applications

This recombinant protein enables:

  1. In Vitro COX Assembly Studies: Investigating interactions between CCDC56 and COX subunits (e.g., mt-CO1, mt-CO2).

  2. Mitochondrial Disease Modeling: Exploring COX deficiencies linked to neurodegenerative disorders.

  3. Structural Analyses: Probing the coiled-coil domain’s role in protein dimerization or tetramerization .

Cross-Species Conservation

CCDC56 is conserved across metazoans, with homologs identified in:

  • Humans: COA3 (UniProt: Q5R7J0) .

  • Mus musculus: Ccdc56 (UniProt: Q9D2R6) .
    This conservation underscores its evolutionary importance in mitochondrial function .

Synonyms and Nomenclature

SynonymFull Name/DescriptionSource
CCDC56Coiled-coil domain-containing protein 56
COA3Cytochrome c oxidase assembly factor 3
MITRAC12Mitochondrial translation regulator

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, kindly indicate it when placing your order, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery details.
Note: All protein shipments default to standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal use, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development according to your specifications.
Synonyms
COA3; CCDC56; Cytochrome c oxidase assembly factor 3 homolog, mitochondrial; Coiled-coil domain-containing protein 56
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-106
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
COA3
Target Protein Sequence
ASSGSGDPLDSKRGEAPFAQRIDPTREKLTPEQLHFMRQAQLAQWQKVLPRRRTRNIVTG LGIGALVLAIHGYTFYSISQERFLDELEDEAKAARARALARASGS
Uniprot No.

Target Background

Function
CCDC56 (Coiled-coil domain-containing protein 56) is a core component of the MITRAC (mitochondrial translation regulation assembly intermediate of cytochrome c oxidase complex) complex. It plays a crucial role in regulating cytochrome c oxidase assembly. MITRAC complexes regulate both the translation of mitochondrial-encoded components and the assembly of nuclear-encoded components imported into the mitochondrion. CCDC56 is essential for efficient translation of MT-CO1 and the assembly of mitochondrial respiratory chain complex IV.
Database Links
Protein Families
COA3 family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein.

Q&A

What is CCDC56 and what is its primary function?

CCDC56, also known as COA3 (Cytochrome c oxidase assembly factor 3 homolog, mitochondrial), is a small mitochondrial protein containing a coiled-coil domain . In Pongo abelii (Sumatran orangutan), the full-length mature protein consists of 105 amino acids (positions 2-106) .

Research indicates that CCDC56 plays a critical role in the assembly and function of cytochrome c oxidase (COX), which is the final enzyme of the mitochondrial electron transport chain . Studies in Drosophila have demonstrated that CCDC56 is necessary for proper COX activity and function, with knockout models showing developmental delay, lethality, and a dramatic decrease in COX levels and activity . The protein appears to be a conserved assembly factor for Complex IV of the oxidative phosphorylation system, making it essential for mitochondrial function and organism viability .

How is CCDC56 evolutionary conserved across species?

CCDC56 shows remarkable evolutionary conservation among metazoans, indicating its fundamental importance in cellular function . While the protein varies slightly in length between species (87 amino acids in flies compared to 106 in humans), there is a significant 42% amino acid identity between Drosophila and human proteins . This conservation suggests strong evolutionary pressure to maintain the structure and function of this protein.

The gene organization also shows interesting evolutionary features. In Drosophila melanogaster, CCDC56 is encoded in a bicistronic transcript with the mitochondrial transcription factor B1 (mtTFB1), representing an unusual gene organization in eukaryotes . This arrangement might reflect functional coupling between these two mitochondrial proteins, although the bicistronic nature may not be conserved in all species. The high degree of conservation across evolutionary distant species makes CCDC56 an interesting target for comparative functional genomics studies.

What expression systems are recommended for recombinant production of CCDC56?

For recombinant expression of CCDC56, multiple expression systems have been successfully employed, each with specific advantages depending on research goals:

  • E. coli expression system: Research indicates successful expression of Pongo abelii CCDC56 with N-terminal His tags in E. coli . This system is advantageous for producing large quantities of protein for structural studies, antibody production, or biochemical assays. The bacterial expression approach was used to generate antibodies against Drosophila CCDC56 by cloning the ORF into pRSET-B vectors .

  • Yeast expression system: For proteins requiring eukaryotic post-translational modifications, yeast systems may be employed, though specific protocols for CCDC56 in yeast were not detailed in the search results .

  • Mammalian expression systems: For functional studies requiring proper folding and potential interaction with other mitochondrial proteins, mammalian expression is preferable. The search results mention a Drosophila CCDC56-FLAG construct cloned into pcDNA3 for mammalian expression .

The choice of expression system should consider the experimental goals—bacterial systems for high yield and structural studies, and eukaryotic systems for functional analyses where proper folding and post-translational modifications are critical.

What purification strategies yield the highest purity and activity for recombinant CCDC56?

Purification of recombinant CCDC56 typically employs affinity chromatography approaches, leveraging fusion tags for selective isolation. Based on available research protocols:

  • His-tag purification: The most common approach involves expressing CCDC56 with an N-terminal histidine tag and purifying via metal affinity chromatography . This method typically yields protein with greater than 90% purity as determined by SDS-PAGE .

  • Storage and stability considerations: The purified protein is often provided in a Tris/PBS-based buffer with 6% Trehalose at pH 8.0 to maintain stability . For long-term storage, it's recommended to add glycerol (final concentration 5-50%, with 50% being optimal) and store at -20°C/-80°C in aliquots to avoid repeated freeze-thaw cycles .

  • Reconstitution protocols: Lyophilized CCDC56 should be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL . Brief centrifugation prior to opening is recommended to bring contents to the bottom of the vial .

For functional studies, it's critical to verify that the purification process preserves the native conformation and activity of the protein. This may require additional purification steps or buffer optimization depending on the specific experimental requirements.

How does CCDC56 contribute to cytochrome c oxidase assembly and function?

CCDC56 plays a crucial role in the assembly and function of cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain . Research in Drosophila has provided significant insights into this function:

  • Assembly role: CCDC56 appears to function as an assembly factor for COX. Knockout studies in Drosophila demonstrated a significant decrease in fully assembled COX complexes, suggesting CCDC56 is required for proper complex formation or stability .

  • Specificity to COX: The specificity of CCDC56 to COX function is demonstrated by the observation that other oxidative phosphorylation complexes remained either unaffected or showed increased activity in CCDC56 knockout larvae, while COX activity was dramatically reduced .

  • Developmental implications: The essentiality of CCDC56 for COX function is further evidenced by the developmental consequences of its absence. CCDC56 knockout in Drosophila resulted in developmental delay and 100% lethality by arrest of larval development at the third instar stage .

  • Conservation of function: The high conservation of CCDC56 across species suggests this assembly function is a fundamental aspect of mitochondrial biogenesis in metazoans .

The exact molecular mechanism by which CCDC56 facilitates COX assembly remains an area of active investigation, with possibilities including direct interaction with COX subunits, assistance in cofactor incorporation, or involvement in intermediate assembly steps.

What experimental models are most suitable for studying CCDC56 function?

Several experimental models have proven valuable for investigating CCDC56 function, each offering distinct advantages depending on research objectives:

  • Drosophila melanogaster model: Fruit flies have been successfully used to create CCDC56 knockout models through P-element transposition techniques . The advantages include:

    • Ability to study developmental effects

    • Relatively quick generation time

    • Availability of genetic tools

    • Similar mitochondrial functions to higher organisms

  • Cell culture systems: For biochemical and cellular studies, various cell lines can be employed:

    • Drosophila Schneider cells for studying the native context of the protein

    • Mammalian cell lines (such as those used with pcDNA3-based expression constructs) for studying human or primate CCDC56 variants

  • Rescue experiments: An important approach involves the rescue of mutant phenotypes through reintroduction of wild-type genes. In Drosophila, the UAS-GAL4 system has been used to express wild-type CCDC56 in knockout backgrounds, demonstrating partial rescue of the lethal phenotype and COX deficiency .

  • Subcellular fractionation approaches: These have been employed to confirm the mitochondrial localization of CCDC56, using differential centrifugation to separate mitochondrial and cytosolic fractions .

The choice of model should align with specific research questions, with Drosophila being particularly valuable for in vivo functional studies and cell culture systems offering advantages for molecular and biochemical analyses.

What techniques are most effective for studying CCDC56-protein interactions?

Investigating protein interactions involving CCDC56 is crucial for understanding its role in COX assembly. Several techniques have proven valuable:

  • Co-immunoprecipitation (Co-IP): This approach can identify direct interaction partners of CCDC56. Using epitope-tagged versions (such as the CCDC56-FLAG construct mentioned in the search results), researchers can pull down CCDC56 complexes and identify binding partners through mass spectrometry or western blotting .

  • Yeast two-hybrid screening: While not specifically mentioned for CCDC56 in the search results, this system could be valuable for identifying binary protein interactions.

  • Proximity labeling approaches: Methods such as BioID or APEX2 proximity labeling could identify proteins in close proximity to CCDC56 within the mitochondrial environment.

  • Crosslinking coupled with mass spectrometry: This approach can capture transient or weak interactions that might be critical for assembly functions.

  • Blue Native PAGE: This technique has been valuable for studying the assembly state of respiratory chain complexes and could be used to examine how CCDC56 affects the formation of COX intermediates and the fully assembled complex .

When designing interaction studies, it's important to consider the mitochondrial localization of CCDC56 and ensure that experimental conditions preserve the native environment as much as possible.

How do mutations in CCDC56 affect mitochondrial function and cellular viability?

The impact of CCDC56 mutations on mitochondrial function has been primarily studied in Drosophila knockout models, revealing several key consequences:

  • Respiratory chain dysfunction: Complete loss of CCDC56 in Drosophila resulted in a dramatic decrease in cytochrome c oxidase (COX) levels and activity, while other respiratory chain complexes remained unaffected or showed compensatory increases . This suggests a specific role in COX assembly or stability rather than a general effect on mitochondrial translation or import.

  • Developmental consequences: CCDC56 knockout flies exhibited developmental delay and 100% lethality by arrest at the third larval instar stage . This illustrates the essential nature of CCDC56 for organismal development and viability.

  • Rescue experiments: Partial rescue of both the lethal phenotype and the COX deficiency through reintroduction of wild-type CCDC56 confirms the specificity of these effects to CCDC56 function .

  • Threshold effects: The partial rescue observed in complementation experiments suggests the possibility of threshold effects, where even reduced levels of functional CCDC56 may support some degree of COX assembly and function .

These findings have implications for understanding potential human mitochondrial disorders related to CCDC56/COA3 dysfunction, as the high conservation of this protein suggests similar consequences might occur in humans with pathogenic variants in this gene.

What is the relationship between CCDC56 and other mitochondrial assembly factors?

CCDC56 (also known as COA3) functions within the context of a complex network of mitochondrial assembly factors. Though the search results don't provide explicit information about interactions with other assembly factors, several inferences can be made:

  • COX-specific assembly pathway: CCDC56's specificity for COX assembly suggests it operates within the COX assembly pathway, which includes numerous other factors such as SURF1, SCO1/2, COX10, COX15, and others. Understanding how CCDC56 coordinates with these factors remains an important research question.

  • Relationship with mtTFB1: In Drosophila, CCDC56 is encoded on a bicistronic transcript with mitochondrial transcription factor B1 (mtTFB1) . This unusual gene organization suggests a potential functional relationship between these proteins, despite their distinct roles (transcription vs. assembly).

  • Position in assembly sequence: The exact stage at which CCDC56 acts in COX assembly (early subassembly, intermediate stages, or final maturation) remains to be precisely determined and represents an important question for future research.

  • Conservation of interactions: Given the evolutionary conservation of CCDC56, comparative studies across species might reveal conserved and divergent aspects of its interaction network.

Research approaches to address these questions might include systematic co-immunoprecipitation studies, genetic interaction screens, or analysis of assembly intermediate accumulation in CCDC56-deficient conditions.

How can structural biology approaches enhance our understanding of CCDC56 function?

Structural studies of CCDC56 would significantly advance our understanding of its molecular function in COX assembly. Several approaches could be considered:

  • X-ray crystallography: Determination of the CCDC56 crystal structure would provide atomic-level details of its folding and potential interaction surfaces. The relatively small size of the protein (106 amino acids in humans, 87 in flies) makes it potentially amenable to crystallization, though the presence of coiled-coil domains might present challenges.

  • NMR spectroscopy: Solution NMR could provide not only structural information but also insights into the dynamics of CCDC56, which might be important for its function in protein-protein interactions during assembly processes.

  • Cryo-electron microscopy: While perhaps challenging due to the small size of CCDC56 alone, cryo-EM could be valuable for visualizing CCDC56 in the context of larger assemblies or intermediate complexes in the COX assembly pathway.

  • Integrative structural biology: Combining multiple approaches (crystallography, NMR, crosslinking mass spectrometry, etc.) might provide complementary information to build comprehensive structural models.

  • Molecular dynamics simulations: Once initial structural data is available, computational approaches could help predict how CCDC56 interacts with potential partners and how these interactions might be affected by mutations.

These structural studies would be particularly valuable if they could capture CCDC56 in complex with its interaction partners or with COX assembly intermediates, providing mechanistic insights into its assembly function.

What are common challenges in working with recombinant CCDC56 and how can they be addressed?

Working with recombinant CCDC56 presents several technical challenges that researchers should anticipate:

  • Solubility and stability issues: As a mitochondrial protein that may interact with membrane-bound complexes, CCDC56 might exhibit solubility challenges. Adding stabilizing agents such as trehalose (6% as used in commercial preparations) or glycerol (5-50%) can help maintain protein stability.

  • Storage considerations: To maintain activity, researchers should:

    • Aliquot the protein to avoid repeated freeze-thaw cycles, which can cause degradation

    • Store working aliquots at 4°C for up to one week

    • Use -20°C/-80°C for long-term storage

  • Expression optimization: When expressing recombinant CCDC56:

    • Consider the expression system carefully (bacterial systems for high yield, eukaryotic systems for proper folding)

    • Optimize induction conditions to balance protein yield with correct folding

    • Include appropriate tags (His-tag has been successfully used) while considering their potential impact on function

  • Functional assays: Given CCDC56's role in COX assembly, developing reliable functional assays may require:

    • Mitochondrial isolation protocols

    • COX activity assays

    • Assembly state analysis by techniques such as blue native PAGE

  • Antibody considerations: If generating antibodies against CCDC56, consider:

    • The small size of the protein may limit epitope availability

    • Expressing the full protein in bacterial systems has been successful for antibody production

Addressing these challenges requires careful optimization of experimental conditions and may benefit from comparing protocols across different model systems.

How can researchers verify the functionality of recombinant CCDC56 in experimental systems?

Verifying that recombinant CCDC56 retains its native function is crucial for experimental validity. Several complementary approaches can be employed:

  • Rescue experiments: The most definitive test is the ability of recombinant CCDC56 to rescue phenotypes in deficient systems:

    • In Drosophila, reintroduction of wild-type CCDC56 via UAS-GAL4 systems partially rescued both the lethal phenotype and COX deficiency in knockout larvae

    • Similar approaches in cell culture models could demonstrate rescue of COX assembly defects

  • Subcellular localization: Functional CCDC56 should correctly localize to mitochondria:

    • Subcellular fractionation followed by western blotting can verify enrichment in mitochondrial fractions

    • Immunofluorescence microscopy with co-localization studies using established mitochondrial markers

  • Protein-protein interactions: Verification that recombinant CCDC56 maintains expected interaction partners:

    • Co-immunoprecipitation studies to confirm interactions with COX assembly components

    • Blue native PAGE to examine incorporation into assembly intermediates

  • Enzymatic assays: Measuring the impact on COX function:

    • COX activity assays in reconstituted systems or following introduction of recombinant CCDC56

    • Polarographic measurements of oxygen consumption

  • Structural integrity: Confirming proper folding:

    • Circular dichroism to verify secondary structure content, particularly important for coiled-coil domains

    • Limited proteolysis to assess conformational stability

These verification steps should be selected based on the specific experimental context and questions being addressed.

What are promising research avenues for further elucidating CCDC56 function?

Several promising research directions could significantly advance our understanding of CCDC56 biology:

  • Mechanistic studies of COX assembly: Determining the precise step at which CCDC56 functions in the COX assembly pathway and identifying its direct interactors would provide mechanistic insights. Techniques such as complexome profiling, which combines blue native PAGE with mass spectrometry, could reveal accumulation of specific assembly intermediates in CCDC56-deficient conditions.

  • Structure-function relationships: Systematic mutagenesis of CCDC56 combined with functional assays could identify critical residues and domains. Particular attention to the coiled-coil domain would help determine if this structural feature is essential for its assembly factor role.

  • Disease relevance: Investigation of potential pathogenic variants in human CCDC56/COA3 in patients with unexplained cytochrome c oxidase deficiency could establish clinical relevance. The findings in Drosophila showing developmental arrest and lethality suggest critical functions that could be disease-associated if partially compromised .

  • Regulatory mechanisms: Understanding how CCDC56 expression is regulated and coordinated with other mitochondrial components would provide insights into mitochondrial biogenesis pathways. The bicistronic arrangement with mtTFB1 in Drosophila raises interesting questions about coordinated expression .

  • Comparative studies: Examining CCDC56 function across evolutionary diverse species could reveal both conserved core functions and species-specific adaptations, providing insights into the evolution of mitochondrial assembly pathways.

These research directions would benefit from integrating multiple methodological approaches and model systems to build a comprehensive understanding of CCDC56 biology.

How might CCDC56 research contribute to understanding mitochondrial diseases?

Research on CCDC56 has significant implications for understanding and potentially addressing mitochondrial diseases:

  • Novel disease mechanisms: As a COX assembly factor, CCDC56 dysfunction represents a potential molecular mechanism for cytochrome c oxidase deficiency, which is associated with a spectrum of mitochondrial disorders. Understanding how CCDC56 contributes to COX assembly could reveal novel pathogenic mechanisms.

  • Genetic diagnosis: Identification of pathogenic variants in CCDC56/COA3 could expand the spectrum of known genetic causes for mitochondrial disorders, improving diagnostic capabilities for patients with unexplained COX deficiency.

  • Genotype-phenotype correlations: The Drosophila studies showing complete lethality with CCDC56 knockout suggest that human disease-causing variants might be hypomorphic rather than complete loss-of-function. Understanding the threshold of CCDC56 function required for viability could help predict disease severity based on specific variants.

  • Therapeutic strategies: Insights into how CCDC56 functions in COX assembly could inform therapeutic approaches for mitochondrial disorders:

    • Gene therapy or protein replacement strategies could be considered for CCDC56-related disorders

    • Understanding bypass mechanisms might reveal alternative pathways that could be therapeutically enhanced

  • Biomarker development: Characterization of cellular consequences of CCDC56 dysfunction could lead to identification of biomarkers for diagnosis or treatment monitoring in related mitochondrial disorders.

The highly conserved nature of CCDC56 across species enhances the translational potential of research findings from model organisms to human health applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.