Recombinant Pongo abelii Cytochrome b561 (CYB561)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pongo abelii CYB561

CYB561 proteins are integral membrane reductases that facilitate trans-membrane electron transfer (TMET) using ascorbate (ASC) as an electron donor . The Pongo abelii (Sumatran orangutan) CYB561 ortholog (UniProt: Q5RCZ2) shares conserved structural and functional motifs with mammalian CYB561 isoforms, including six trans-membrane (TM) α-helices coordinating two b-type hemes . Recombinant production enables detailed study of its redox behavior, substrate interactions, and physiological roles.

Functional Characteristics

Redox properties:

  • Heme centers: Two b-type hemes with distinct midpoint potentials (ΔE ~100 mV) .

    • High-potential (HP) heme: Cytoplasmic side, E₀′ ≈ +144 to +165 mV .

    • Low-potential (LP) heme: Intra-vesicular side, E₀′ ≈ -19 to +57 mV .

  • Ascorbate binding: Binds ASC at two sites with differing affinities (Kd ~0.045 mM and 2.34 mM) .

Key roles:

  • ASC regeneration: Reduces monodehydroascorbate radicals, maintaining cellular redox balance .

  • Fe³⁺ reduction: Supports iron uptake by reducing ferric iron for transmembrane transport .

Experimental Applications

Recombinant Pongo abelii CYB561 is utilized in:

  • ELISA assays: Quantifying CYB561 expression in oxidative stress studies .

  • Spectroscopic analyses: Investigating heme environments via UV-Vis and EPR spectroscopy .

  • Mutagenesis studies: Probing conserved residues (e.g., His ligands) to dissect electron transfer mechanisms .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are open to fulfilling any specific format requirements you may have. Please indicate your preference in the order notes section, and we will prepare your order accordingly.
Lead Time
Delivery time may vary based on your purchasing method and location. We recommend consulting your local distributors for specific delivery estimates.
Note: All protein shipments default to standard blue ice packs. If dry ice packaging is required, please notify us in advance as additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal stability, store working aliquots at 4°C for up to one week.
Reconstitution
Prior to opening, we recommend briefly centrifuging the vial to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%, which can be used as a reference point.
Shelf Life
The shelf life of our products is influenced by various factors including storage conditions, buffer components, temperature, and the inherent stability of the protein itself.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. For lyophilized forms, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during the production process. If you have a preference for a particular tag, please inform us and we will prioritize the development of your specified tag.
Synonyms
CYB561; Transmembrane ascorbate-dependent reductase CYB561; Cytochrome b-561; Cytochrome b561
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-251
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
CYB561
Target Protein Sequence
MEGGAAASTPAALPYYVAFSQLLGLTLVAMTGAWLGLYRGGIAWESDLQFNAHPLCMVIG LIFLQGDALLVYRVFRNEAKRTTKVLHGLLHIFALVIALVGLVAVFDYHRKEGYADLYSL HSWCGILVFVLYFVQWLVGFSFFLFPGASFSLRSRYRPQHIFFGATIFLLSVGTALLGLK EALLFKLRDKYSAFEPEGVLANVLGLLLACFGGAVLYILTRADWKRPSQAEEQALSMDFK TLTEGDSPGSQ
Uniprot No.

Target Background

Function
Cytochrome b561 is a transmembrane reductase that utilizes ascorbate as an electron donor in the cytoplasm. It facilitates the transfer of electrons across membranes, reducing monodehydro-L-ascorbate radical in the lumen of secretory vesicles. This process is crucial for the regeneration and homeostasis of ascorbate within secretory vesicles, providing the necessary reducing equivalents to support the activity of intravesicular enzymes.
Database Links
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, chromaffin granule membrane; Multi-pass membrane protein.

Q&A

What is the basic structure of Pongo abelii Cytochrome b561?

Pongo abelii Cytochrome b561 (CYB561) is an integral membrane protein characterized by six trans-membrane domains and two heme-b redox centers positioned on opposite sides of the host membrane. Like other members of the CYB561 family, it contains four highly conserved histidine residues in the central four trans-membrane helices that coordinate the two heme-b chromophores . The protein's structure enables its defining characteristic: trans-membrane electron transfer capability. While the atomic structure of Pongo abelii CYB561 has not been directly resolved, it likely shares significant structural homology with other CYB561 family members, such as those from Arabidopsis thaliana and human duodenal protein, whose structures have been determined .

How does Cytochrome b561 facilitate electron transfer across membranes?

Cytochrome b561 proteins facilitate electron transfer across membranes through their unique arrangement of two heme-b centers positioned on opposite sides of the membrane. These proteins are characterized by their ascorbate reducibility and trans-membrane electron transferring capability . The electron transfer pathway likely involves the reduction of one heme center (typically the high-potential heme on the cytoplasmic side) by ascorbate, followed by internal electron transfer to the second heme (typically the low-potential heme on the lumenal side) . This arrangement enables the protein to transfer electrons from cytoplasmic ascorbate to reduce monodehydroascorbate in the lumen, thereby providing reducing equivalents for lumenal monooxygenases .

What expression systems are most effective for producing recombinant Pongo abelii CYB561?

Based on successful expression of other CYB561 family members, two expression systems have proven particularly effective:

  • Yeast (Saccharomyces cerevisiae) expression system: This has been successfully used for mouse CYB561D1 (Mm_CYB561D1) . The advantage of this eukaryotic system is its ability to properly integrate membrane proteins and potentially provide post-translational modifications.

  • Bacterial (E. coli) expression system: This has been effective for bovine CYB561A1 (Bt_CYB561A1) . For optimal expression, the bacteria should be grown in the presence of heme, δ-aminolevulinic acid, and isopropyl-1-thio-β-D-galactopyranoside at lower temperatures (around 20°C) for 24 hours .

For Pongo abelii CYB561, initial screening of both systems is recommended, with subsequent optimization based on protein yield and functionality.

What is the most effective purification protocol for recombinant Pongo abelii CYB561?

A recommended purification protocol based on successful purification of other CYB561 proteins involves:

  • Membrane fraction isolation: Following expression, cells should be disrupted and membrane fractions isolated by differential centrifugation.

  • Detergent solubilization: The membrane proteins can be solubilized using n-dodecyl-β-D-maltoside (DDM) at approximately 1.5 g detergent per gram of total protein in a buffer containing 0.1 M potassium phosphate (pH 7.2) with 5% glycerol, stirring overnight at 0-4°C .

  • Affinity chromatography: If the recombinant protein contains a His-tag, TALON Resin affinity chromatography can be used for purification .

  • Size exclusion chromatography: Further purification can be achieved using Sephacryl 300 HR .

This protocol typically yields ~90% electrophoretically pure recombinant cytochrome, though optimization may be necessary for specific constructs .

What spectroscopic methods are most informative for characterizing Pongo abelii CYB561?

Multiple complementary spectroscopic techniques provide comprehensive characterization:

  • Optical Absorption Spectroscopy: This reveals the characteristic Soret and α/β bands of heme proteins. For CYB561 proteins, the ratio of A(280 nm) to A(Soret peak) can indicate sample purity, with values below 0.4 suggesting high purity .

  • Circular Dichroism (CD) Spectroscopy: CD spectra between 380-600 nm can detect potential electronic interactions between the two heme-b chromophores. The presence or absence of exciton splitting in the Soret-band provides information about heme interactions .

  • Electron Paramagnetic Resonance (EPR) Spectroscopy: EPR can distinguish between different types of heme environments, including conventional low-spin species (g = ~3.1) and highly-axial low-spin (HALS) species (g = ~3.7) . This technique is particularly valuable for identifying the spin state of the heme iron and detecting any asymmetry in the heme centers.

How can researchers distinguish between the two heme centers in Pongo abelii CYB561?

The two heme centers in CYB561 proteins can be distinguished through:

  • Redox Potential Differences: The high-potential heme (bH) typically has a redox potential around 150-170 mV, while the low-potential heme (bL) has a redox potential around 20-80 mV .

  • EPR Spectroscopy: The two hemes often display distinct EPR signals, with the high-potential heme showing a signal at g = ~3.1 (conventional low spin) and the low-potential heme showing a signal at g = ~3.7 (highly-axial low spin or HALS) .

  • Differential Ascorbate Reduction: Titration with increasing ascorbate concentrations can reveal biphasic reduction patterns, corresponding to the two heme centers with different ascorbate affinities .

  • Site-directed Mutagenesis: Selective mutation of histidine residues that coordinate each heme can help assign spectral features to specific heme centers .

What methods can accurately determine the reduction potentials of Pongo abelii CYB561 heme centers?

Accurate determination of reduction potentials requires:

  • Potentiometric Titrations: The most direct method involves monitoring the absorbance changes at 561 nm during carefully controlled redox titrations. Data from these titrations can be fitted to the equation:

F = (1 − FH)/(1 + 10^((E − Em(bL))/59)) + FH/(1 + 10^((E − Em(bH))/59))

Where F is the fraction of maximal change in A561, FH is the fraction associated with the high-potential heme, Em(bL) and Em(bH) are the midpoint potentials for the low- and high-potential hemes, respectively .

  • Mediated Redox Titrations: These should employ appropriate redox mediators covering the expected potential range (-100 to +200 mV vs. SHE) to ensure equilibrium between the solution potential and the protein .

  • Controlled Atmosphere: Titrations should be performed under anaerobic conditions to prevent oxygen interference with the measurements .

How can researchers accurately measure ascorbate binding and its relationship to electron transfer?

Measuring ascorbate binding and electron transfer involves:

  • Spectrophotometric Titration: The protein (~4 μM) in buffer containing detergent (e.g., 0.075% n-dodecyl-β-D-maltoside) should be titrated with increasing ascorbate concentrations (typically ranging from 0.13 to 20,200 μM). The extent of reduction can be calculated from the increase in absorbance at 561 nm, corrected for dilution .

  • Binding Constant Determination: Ascorbate titration data should be analyzed using appropriate binding models to determine high-affinity and low-affinity binding constants.

  • Anaerobic Conditions: For precise measurements, titrations should be performed under anaerobic conditions in a sealed titrator to prevent interference from oxygen .

The table below compares ascorbate binding properties and reduction potentials of different CYB561 proteins, which can serve as a reference for Pongo abelii CYB561 characterization:

CYB561 ProteinExpression SystemHigh-Affinity Asc Binding Site (mM)Low-Affinity Asc Binding Site (mM)Reduction Potentials (mV)EPR Signal (g Value)
Bt_CYB561A1none??150 (E high) / 60 (E low)3.69 / 3.13
Bt_CYB561A1E. coli0.00530.394171 (E high) / 81 (E low)3.72 / 3.15
Mm_CYB561A1S. cerevisiae0.0161.24160 (E high) / 20 (E low)3.71 / 3.27

Which amino acid residues are critical for heme coordination in Pongo abelii CYB561?

Based on studies of other CYB561 proteins, the following residues would likely be critical:

  • Conserved Histidine Residues: Four histidine residues across the central four trans-membrane helices are essential for coordinating the two heme-b centers . In bovine CYB561A1, these were identified as His54/His122 for one heme and His88/His161 for the other heme .

  • Additional Heme-interacting Residues: His92 and His110 in bovine CYB561A1 have been shown to selectively affect different heme centers (the high-potential and low-potential hemes, respectively), suggesting their involvement in the heme pockets .

  • Experimental Validation: Site-directed mutagenesis of these conserved histidines in Pongo abelii CYB561 would be crucial to confirm their roles. Mutations of the axial histidine ligands typically result in significantly reduced protein expression and stability .

How can researchers design effective mutagenesis studies to probe structure-function relationships?

Effective mutagenesis studies should:

  • Target Conserved Residues: Sequence alignment with well-characterized CYB561 proteins should guide selection of conserved histidine residues for mutation.

  • Consider Multiple Substitution Types: Different amino acid substitutions can provide different insights:

    • Glutamine substitutions maintain similar size and hydrogen-bonding capability

    • Tyrosine substitutions test the possibility of axial ligation by tyrosinate

    • Methionine substitutions test the possibility of alternative coordination

    • Leucine substitutions remove coordination capability while maintaining hydrophobicity

  • Quantify Expression Efficiency: Expression levels should be quantified by immunoblot and dot blot assays, as dramatic decreases in expression often indicate disruption of crucial structural elements .

  • Characterize Functional Impact: Each mutant should be characterized for:

    • Ascorbate reducibility

    • Redox potentials of remaining heme centers

    • Spectroscopic properties (UV-Vis, CD, EPR)

    • Electron transfer capability

How does Pongo abelii CYB561 compare to other primate CYB561 proteins?

While specific comparisons of Pongo abelii CYB561 with other primate CYB561 proteins are not directly available in the search results, researchers should:

  • Perform phylogenetic analysis: Construct evolutionary trees using CYB561 sequences from various primates, including humans, chimpanzees, gorillas, and orangutans.

  • Compare sequence identity and similarity: Particularly focus on the conserved histidine residues and ascorbate binding sites.

  • Analyze differential expression patterns: Examine tissue-specific expression patterns across primate species, similar to how mouse Cyb561d1 gene expression has been characterized in thymus, spleen, colon, and large intestine .

  • Investigate functional conservation: Compare electron transfer capabilities, redox potentials, and ascorbate affinities across primate CYB561 proteins.

What evolutionary insights can be gained from studying Pongo abelii CYB561?

Evolutionary studies of Pongo abelii CYB561 could reveal:

  • Conservation of Functional Domains: Analysis of sequence conservation across species can identify critical functional regions that have been maintained throughout evolution.

  • Primate-specific Adaptations: Comparison with non-primate mammals may reveal adaptations specific to primates or great apes.

  • Relationship to Physiological Functions: Correlate evolutionary changes with physiological differences between species, particularly in tissues with high expression levels of CYB561.

  • Positive Selection Analysis: Identification of positively selected sites might indicate regions that have adapted to species-specific functions or environments.

How can homology modeling be used to predict the structure of Pongo abelii CYB561?

Homology modeling for Pongo abelii CYB561 should incorporate:

  • Template Selection: Use experimentally determined structures of CYB561 family members as templates, particularly the human duodenal protein (Hs_CYB561A2) and the Arabidopsis thaliana protein (At_CYB561B2), whose atomic structures have been resolved .

  • Sequence Alignment Optimization: Pay particular attention to aligning the conserved histidine residues that coordinate the heme centers.

  • Model Refinement: Refine the model with particular attention to:

    • Transmembrane helix positioning

    • Heme coordination geometry

    • Ascorbate binding sites

    • Putative electron transfer pathways

  • Validation: Validate the model through:

    • Ramachandran plot analysis

    • Comparison with experimental data from spectroscopic studies

    • Molecular dynamics simulations to test stability

What are the potential physiological roles of Pongo abelii CYB561 based on functions of other CYB561 proteins?

Based on functions attributed to other CYB561 family members, potential physiological roles include:

  • Ascorbate Regeneration: Providing reducing equivalents for lumenal monooxygenases by reducing monodehydroascorbate at the expense of cytoplasmic ascorbate .

  • Iron Homeostasis: Some CYB561 proteins are involved in iron reduction and transport processes.

  • Antioxidant Defense: Protection against oxidative stress through regeneration of ascorbate pools.

  • Specialized Tissue Functions: Given the high expression of mouse Cyb561d1 in thymus, spleen, colon, and large intestine , Pongo abelii CYB561 may have important roles in immune tissues and the digestive system.

  • Potential Roles in Disease: Some CYB561 proteins in humans and rodents have been implicated in cancer pathology . Research into Pongo abelii CYB561 could provide evolutionary insights into these connections.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.