Recombinant Pongo abelii Cytochrome c oxidase assembly protein COX11, mitochondrial (COX11)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Pongo abelii cytochrome c oxidase assembly protein COX11, mitochondrial (COX11) is a biotechnologically engineered protein critical for studying mitochondrial respiratory chain assembly. Produced in E. coli with an N-terminal His tag, this 249-amino-acid protein (29–277 aa, UniProt ID: Q5R7U6) facilitates copper ion delivery to cytochrome c oxidase (Complex IV) during its maturation . Its recombinant form enables biochemical and structural investigations into mitochondrial energy production mechanisms and associated pathologies.

Key Features

PropertyDetails
Source OrganismPongo abelii (Sumatran orangutan)
Expression SystemEscherichia coli
TagN-terminal polyhistidine (His-tag)
Molecular Weight~30 kDa (calculated)
Amino Acid Sequence249 residues (29–277 aa)
Purity>90% (SDS-PAGE)
StorageLyophilized at -20°C/-80°C; reconstituted in Tris/PBS buffer + 6% trehalose

Functional Role in Mitochondrial Complex IV Assembly

COX11 operates in the final stages of Complex IV (cytochrome c oxidase) biogenesis:

  1. Copper Delivery: Dimeric COX11 transfers Cu(I) ions from a 2Cu(I)-4S cluster to the Cu<sub>B</sub> site of the catalytic subunit MT-CO1 .

  2. Assembly Intermediate Stabilization: Interacts with SURF1 (Shy1 in yeast) and structural subunits COX4/COX5A during heme A insertion .

  3. Redox Regulation: Requires reduced cysteine residues (maintained by COX19) for copper transfer efficiency .

Mechanistic Overview:

  1. COX11 dimer "floats" on the mitochondrial inner membrane, anchored by transmembrane helices.

  2. Flexible linkers position the 2Cu(I)-4S cluster near MT-CO1’s histidine ligands.

  3. Thiolate coordination transfers Cu(I) to MT-CO1, forming the Cu<sub>B</sub> center .

Disease Associations

ConditionPathogenic MechanismExperimental Evidence
Mitochondrial EncephalopathyBiallelic COX11 variants impair ATP synthesisReduced ATP in patient fibroblasts; rescued by CoQ<sub>10</sub> supplementation
Leigh SyndromeHeterozygous mutations disrupt COX11 stabilityYeast models show growth defects and redox imbalance

Functional Studies

  • Yeast Complementation: S. cerevisiae COX11 homologs cannot be replaced by Arabidopsis COX11, highlighting species-specific functional divergence .

  • Plant Models: Arabidopsis COX11 knockdowns exhibit 50% reduced COX activity, root growth defects, and impaired pollen germination .

Recombinant COX11 Variants

Product CodeSpeciesTagSourceVendor
RFL25127PFPongo abeliiHisE. coliCreative BioMart
CSB-CF728956PYXPongo abeliiVariableE. coliCusabio
COX11-1993HFHumanGSTMammalianCreative BioMart

Antibodies and Kits

  • Anti-COX11 Antibodies: Available for human, mouse, and rat (e.g., CSB-PA005825GA01HU) .

  • ELISA Kits: Detect recombinant COX11 at 1.0–10 ng/mL sensitivity .

Technical Considerations

  • Reconstitution: Requires sterile deionized water + 5–50% glycerol for long-term stability .

  • Activity Assays: Monitor COX activity via polarographic oxygen measurements or BN-PAGE of assembly intermediates .

  • Mutagenesis Studies: Cys-111Ala mutations abolish copper transfer, confirming redox-sensitive functionality .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested. Advance notification is required for dry ice shipping, and additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline for your reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If a specific tag type is required, please inform us, and we will prioritize its development.
Synonyms
COX11; Cytochrome c oxidase assembly protein COX11, mitochondrial
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-277
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
AERVEPFLRPECSGTGGAGRGLRWLGTWKRCSLGARHPALQPPRRHKNSNPFTRAQKEEW RRRNKTTLTYVAAVAVGMLGASYAAVPLYRLYCQTTGLGGSAVAGHASDKIENMVPVKDR IIKISFNADVHASLQWNFRPQQTEIYVVPGETALAFYRAKNPTDKPVIGISTYNIVPFEA GQYFNKIQQCFCFEEQRLNPQEEVDMPVFFYIDPEFAEDPRMIKVDLITLSYTFFEAKEG HKLPVPGYN
Uniprot No.

Target Background

Function
This protein functions at a late stage of cytochrome c oxidase synthesis, likely facilitating the incorporation of copper B into subunit I.
Database Links
Protein Families
COX11/CtaG family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein; Intermembrane side.

Q&A

What is the primary function of COX11 in mitochondria?

COX11 functions as a copper chaperone that participates in the assembly of complex IV (cytochrome c oxidase) of the mitochondrial respiratory chain. It plays a critical role in facilitating the incorporation of copper ions into the catalytic center of complex IV, which is essential for electron transport and cellular respiration. This copper chaperone activity is highly conserved across species, from unicellular organisms to primates, indicating its fundamental importance in cellular bioenergetics. Defects in COX11 function can lead to impaired complex IV assembly and decreased cellular ATP production .

What is the structural organization of the COX11 protein?

The COX11 protein has a distinctive three-dimensional structure characterized by:

  • A β-strand fold organized into a homodimeric structure

  • An antiparallel arrangement forming a binuclear copper cluster at the dimer interface

  • N-terminal transmembrane helices that anchor the dimer to the inner mitochondrial membrane

  • Orientation of the two copper ions toward the membrane to facilitate copper transfer

This structural arrangement positions the protein optimally for its function in copper delivery to the nascent cytochrome c oxidase complex. The copper-binding site is formed at the interface between two monomers, creating a binuclear copper cluster that is essential for its chaperone activity .

How does the COX11 sequence in Pongo abelii compare to human COX11?

While the search results don't provide specific sequence comparisons between Pongo abelii and human COX11, evolutionary conservation analyses suggest high similarity across primates. Critical functional domains, particularly the copper-binding motifs and transmembrane regions, show strong conservation. The copper-binding domain typically contains conserved cysteine residues that are essential for metal coordination. For conducting comparative studies, researchers should consider that while the core functional domains are highly conserved, species-specific variations may occur in less functionally constrained regions, potentially affecting protein stability or interaction profiles .

What are the optimal expression systems for recombinant Pongo abelii COX11 production?

For recombinant expression of Pongo abelii COX11, several expression systems can be employed based on research requirements:

Bacterial Expression (E. coli):

  • Advantages: High yield, cost-effective, rapid growth

  • Considerations: May lack proper post-translational modifications; requires optimization of codon usage for primate sequences

  • Recommended for: Structural studies, antibody production, protein-protein interaction studies

Yeast Expression (S. cerevisiae):

  • Advantages: Eukaryotic post-translational modifications, suitable for functional studies

  • Applications: Particularly valuable for complementation studies as demonstrated in COX11 mutation research

  • Methodology: Transformation with shuttle vectors containing the Pongo abelii COX11 gene under control of an inducible promoter

Mammalian Cell Lines:

  • Advantages: Most physiologically relevant system, proper folding and modifications

  • Applications: Functional studies, localization experiments, interaction analyses

  • Methodology: Transient or stable transfection with expression vectors containing CMV or similar promoters

The choice of expression system should be guided by the specific research questions. For studies focusing on basic protein-protein interactions, bacterial systems may suffice, while functional studies would benefit from yeast or mammalian expression systems .

What methods are effective for assessing COX11 protein-protein interactions?

Multiple complementary approaches can be employed to characterize COX11 protein-protein interactions:

Co-immunoprecipitation (Co-IP):

  • Methodology: Use of specific antibodies against COX11 or potential interacting partners to pull down protein complexes

  • Analysis: Western blotting to detect co-precipitated proteins

  • Advantages: Captures native interactions in cellular context

Yeast Two-Hybrid (Y2H):

  • Methodology: Fusion of COX11 to DNA-binding domain and target proteins to activation domain

  • Analysis: Reporter gene activation indicates interaction

  • Applications: Screen for novel interaction partners or validate specific interactions

Bimolecular Fluorescence Complementation (BiFC):

  • Methodology: Split fluorescent protein fragments fused to COX11 and potential partners

  • Analysis: Fluorescence microscopy to detect reconstituted fluorescence

  • Advantages: Visualizes interactions in living cells with subcellular resolution

Evidence from research on human COX11 suggests interactions with other components of the cytochrome c oxidase assembly pathway. For example, interaction studies have shown that COX11 can interact with cytochrome c oxidase subunits, particularly with the COX1 subunit during copper insertion. In particular, Os_CoxVIIa, a subunit of cytochrome c oxidase, has been observed to interact with Cox11 in some experimental systems .

How can researchers effectively measure COX11 chaperone activity in vitro?

Assessment of COX11 chaperone activity requires specialized biochemical assays focusing on copper handling and transfer capabilities:

Copper-Binding Assay:

  • Methodology: Incubation of purified recombinant COX11 with copper ions (Cu^1+) followed by size exclusion chromatography

  • Analysis: Atomic absorption spectroscopy or ICP-MS to quantify bound copper

  • Controls: Mutated versions of COX11 with alterations in copper-binding sites

Copper Transfer Assay:

  • Methodology: Pre-loading COX11 with copper and measuring transfer to acceptor proteins/peptides

  • Analysis: Fluorescent probes sensitive to copper binding or displacement

  • Applications: Determine copper transfer kinetics and specificity

Complex IV Assembly Assay:

  • Methodology: Complementation of COX11-deficient cell lines with wild-type or mutant COX11

  • Analysis: BN-PAGE (Blue Native Polyacrylamide Gel Electrophoresis) to assess complex IV assembly

  • Quantification: Activity staining for cytochrome c oxidase activity

Research has shown that mutations affecting conserved cysteine residues can significantly impact copper binding and transfer functions. For example, studies of Cox11 homologs have demonstrated that cysteine residues at positions equivalent to human positions 25 and 126 are essential for function .

What are the known pathogenic variants in COX11 and their functional consequences?

Several pathogenic variants in COX11 have been identified and characterized:

MutationProtein ChangeStructural/Functional ImpactClinical Presentation
p.A244PAlanine to Proline at position 244Altered protein stability (ΔΔG monomer: 0.93 ± 0.04 kcal/mol)Infantile-onset mitochondrial encephalopathy
p.P247TProline to Threonine at position 247Reduced stability (ΔΔG monomer: 1.841 ± 0.002 kcal/mol)Leigh-like features
p.T256Nfs*8Frameshift leading to premature terminationSevere destabilization (ΔΔG monomer: 12.99 ± 2.27 kcal/mol)Compound heterozygous with P247T causing Leigh-like disease

These mutations predominantly affect protein stability rather than directly impacting the copper-binding site. The frameshift mutation (p.T256Nfs*8) causes the most severe structural disruption, replacing the C-terminal 21 amino acids with 7 alternative amino acids. Structure-based analysis reveals that these mutations alter protein flexibility and dynamics, particularly in regions where the mutated residues are located .

How do mutations in COX11 affect mitochondrial function and energy metabolism?

Mutations in COX11 lead to cascading effects on mitochondrial function:

  • Impaired Complex IV Assembly: Primary consequence of COX11 dysfunction, resulting in reduced cytochrome c oxidase levels

  • Decreased Cellular ATP Production: Reduction in oxidative phosphorylation capacity

  • Metabolic Reprogramming: Shift toward glycolytic metabolism to compensate for impaired respiration

  • Increased Sensitivity to Oxidative Stress: Particularly evident in cells with truncated COX11, suggesting a potential role in redox homeostasis

Intriguingly, ATP levels in cells with COX11 mutations can be partially rescued by coenzyme Q10 (CoQ10) supplementation, despite COX11 having no known direct role in CoQ10 biosynthesis. This suggests complex metabolic interactions between different components of the respiratory chain and potential compensatory mechanisms that could be therapeutically exploited .

Studies using COX11-deficient models have demonstrated altered growth patterns and substantial metabolic disruptions, highlighting the critical role of properly functioning COX11 in maintaining energy homeostasis .

What are the most promising therapeutic approaches for COX11-associated disorders?

Based on current research, several therapeutic strategies show potential for addressing COX11-associated disorders:

CoQ10 Supplementation:

  • Mechanism: While not directly addressing the primary defect, CoQ10 has been shown to improve ATP production in COX11-deficient cells

  • Evidence: Functional studies showed that mutant COX11 fibroblasts had decreased ATP levels which could be rescued by CoQ10 supplementation

  • Application: May serve as a metabolic bypass strategy to enhance electron transport

Copper Supplementation:

  • Rationale: As COX11 functions as a copper chaperone, copper bioavailability might influence disease severity

  • Considerations: Requires careful dosing due to potential toxicity; may be more effective in certain variants

Gene Therapy Approaches:

  • Strategy: Delivery of functional COX11 using viral vectors

  • Target tissues: Primarily affected tissues such as brain and muscle

  • Challenges: Delivery across blood-brain barrier, achieving appropriate expression levels

Small Molecule Chaperones:

  • Approach: Compounds that stabilize mutant COX11 protein structure

  • Mechanism: Prevention of protein misfolding and degradation

  • Candidates: Structure-based drug design targeting specific variants

The discovery that CoQ10 can rescue ATP production in COX11-deficient cells represents a particularly interesting finding that merits further investigation for clinical applications .

How can COX11 be used as a model to study mitochondrial copper trafficking?

COX11 provides an excellent model system for investigating mitochondrial copper trafficking mechanisms:

Copper Sensing Applications:

  • Approach: Engineering COX11-based fluorescent biosensors for mitochondrial copper

  • Methodology: Fusion of fluorescent protein domains to COX11 to create FRET-based sensors

  • Applications: Real-time monitoring of copper dynamics in living cells

Cross-Species Comparative Studies:

  • Approach: Analysis of COX11 structure and function across evolutionary distinct organisms from yeast to primates

  • Benefits: Identification of conserved mechanisms and species-specific adaptations

  • Application: Using lower organisms like yeast as tractable models for human disease

Mitochondrial Copper Homeostasis Network:

  • Research focus: Mapping interactions between COX11 and other copper chaperones/transporters

  • Methodology: Proteomics approaches to identify the complete interactome

  • Significance: Understanding the integrated network controlling mitochondrial copper utilization

The structural analysis of COX11 reveals a binuclear copper cluster at the dimer interface, with N-terminal transmembrane helices anchoring the dimer to the inner mitochondrial membrane. This specific arrangement facilitates copper transfer, making COX11 an ideal model for studying copper trafficking mechanisms in mitochondria .

What role does COX11 play in oxidative stress responses?

Emerging evidence suggests COX11 involvement in cellular responses to oxidative stress:

Peroxide Sensitivity:

  • Observation: Premature truncation of COX11 leads to increased sensitivity to hydrogen peroxide

  • Mechanism: Potentially related to impaired respiratory chain function leading to increased ROS production

  • Experimental evidence: Yeast models with truncated COX11 (Y250*) show significantly increased sensitivity to oxidative challenges

Redox Signaling:

  • Hypothesis: COX11 may function in redox signaling pathways beyond its role in complex IV assembly

  • Supporting evidence: Conserved cysteine residues (positions 25 and 126) that are sensitive to oxidation state

  • Potential mechanism: Conformational changes in response to redox environment affecting protein interactions

Antioxidant Defense Connection:

  • Observation: COX11 deficiency alters cellular redox status

  • Research direction: Investigation of links between COX11 function and antioxidant defense systems

  • Methodology: Measuring oxidative stress markers and antioxidant enzyme activities in COX11-deficient models

The dual roles observed in some COX11 homologs, such as immunosuppression and cell death induction during pathogenesis, may provide insights into how this protein family responds to and influences cellular stress responses .

How can comparative studies between human and Pongo abelii COX11 advance our understanding of primate mitochondrial evolution?

Comparative studies between human and Pongo abelii COX11 can provide valuable evolutionary insights:

Evolutionary Rate Analysis:

  • Approach: Calculation of dN/dS ratios to identify selective pressures on COX11 in different primate lineages

  • Hypothesis: Conservation of functional domains versus potential adaptive evolution in lineage-specific regions

  • Methodology: Phylogenetic analysis incorporating multiple primate species

Structure-Function Relationships:

  • Focus: Identifying species-specific variations that might affect protein stability or interaction profiles

  • Approach: Recombinant expression of both human and Pongo abelii COX11 for comparative functional assays

  • Applications: Testing interchangeability in complementation experiments

Mitochondrial-Nuclear Co-evolution:

  • Research question: How has COX11 (nuclear-encoded) co-evolved with mitochondrial-encoded complex IV subunits?

  • Significance: Understanding constraints in mitonuclear protein interactions across primates

  • Methodology: Correlation analysis between COX11 changes and mitochondrial genome evolution

While the search results don't provide direct comparative data between human and Pongo abelii COX11, such studies would contribute significantly to our understanding of primate mitochondrial evolution and potentially identify species-specific adaptations in energy metabolism .

What are the most reliable methods for quantifying COX11 expression levels?

Accurate quantification of COX11 expression requires appropriate methodology selection based on research objectives:

RT-qPCR (mRNA Quantification):

  • Protocol: RNA extraction, reverse transcription, and quantitative PCR with COX11-specific primers

  • Reference genes: Recommended stable references include GAPDH, ACTB, and mitochondrial housekeeping genes

  • Applications: Tissue expression profiling, response to experimental conditions

  • Considerations: Measures transcript levels, not protein abundance

Western Blotting (Protein Quantification):

  • Protocol: Subcellular fractionation to isolate mitochondria prior to SDS-PAGE and immunoblotting

  • Loading controls: Mitochondrial markers such as VDAC or complex II subunits

  • Quantification: Densitometric analysis with normalization to loading controls

  • Applications: Protein abundance studies, mutation impact assessment

Immunofluorescence Microscopy (Localization and Semi-quantification):

  • Protocol: Fixation, permeabilization, and immunostaining with COX11-specific antibodies

  • Colocalization: With mitochondrial markers such as MitoTracker or TOM20

  • Analysis: Image quantification using fluorescence intensity measurements

  • Applications: Subcellular localization, potential mislocalization of mutant forms

For comprehensive analysis, combining multiple methodologies is recommended. For instance, in studies of COX11 mutations, researchers employed both protein quantification and localization studies to characterize the impact of specific variants on protein expression and distribution .

How should researchers interpret complex IV activity data in relation to COX11 manipulation?

Interpretation of complex IV activity in relation to COX11 manipulation requires consideration of several factors:

Activity Assay Selection:

  • Spectrophotometric assays: Measure cytochrome c oxidation rate

  • Polarographic methods: Oxygen consumption measurement

  • Histochemical staining: Visual assessment of complex IV activity in tissues or cells

Data Interpretation Framework:

ParameterNormal COX11Partial COX11 DeficiencyComplete COX11 Loss
Complex IV Activity100%30-70% of control<10% of control
Assembly StatusFully assembled complexPartially assembled intermediatesAbsence of fully assembled complex
Copper ContentNormal copper incorporationReduced copper in complex IVMinimal copper incorporation

Confounding Factors:

  • Compensatory mechanisms: Upregulation of alternative respiratory pathways

  • Tissue-specific effects: Differential sensitivity across cell types

  • Threshold effects: Nonlinear relationship between COX11 levels and complex IV activity

Research has shown that complete depletion of complex IV activity, as observed in the cox11
mutant in P. patens, leads to altered growth patterns and significant metabolic disruptions. This highlights the critical threshold of complex IV activity required for normal cellular function .

What statistical approaches are most appropriate for analyzing COX11 mutation effects on protein stability?

Analysis of COX11 mutation effects on protein stability requires robust statistical methods:

Thermodynamic Stability Analysis:

  • Approach: Calculation of ΔΔG values (difference in Gibbs free energy between wild-type and mutant protein)

  • Tool recommendation: FoldX or similar computational tools

  • Statistical handling: Multiple independent runs (e.g., five runs) to establish confidence intervals

  • Significance threshold: Changes within predicted error range of 0.5 kcal/mol considered insignificant

Comparative Mutation Analysis:

  • Method: ANOVA with post-hoc tests for comparing multiple mutations

  • Application: Ranking mutations by severity of impact on protein stability

  • Visualization: Box plots or violin plots to display distribution of stability predictions

Structure-Function Correlation:

  • Approach: Regression analysis between stability metrics and functional outcomes

  • Variables: ΔΔG values versus biochemical or cellular phenotypes

  • Application: Establishing predictive models for mutation pathogenicity

In a study of COX11 mutations, researchers employed five independent runs for each mutation and calculated the thermodynamic stability changes. The analysis revealed a hierarchy of destabilizing effects: T256Nfs*8 (ΔΔG monomer: 12.99 ± 2.27 kcal/mol) > P247T (1.841 ± 0.002 kcal/mol) > A244P (0.93 ± 0.04 kcal/mol). This quantitative approach allows for precise assessment of mutation impacts on protein stability .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.