Recombinant Pongo abelii Cytochrome c oxidase subunit 2 (MT-CO2)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Pongo abelii Cytochrome c Oxidase Subunit 2 (MT-CO2)

Recombinant Pongo abelii Cytochrome c oxidase subunit 2 (MT-CO2) is a mitochondrial protein that plays a crucial role in the electron transport chain, which is essential for cellular respiration. This protein is encoded by the mitochondrial DNA of the Sumatran orangutan (Pongo abelii), a species known for its unique evolutionary adaptations and conservation status. The cytochrome c oxidase complex, of which MT-CO2 is a part, catalyzes the reduction of oxygen to water, thereby facilitating ATP production through oxidative phosphorylation.

Amino Acid Composition

The amino acid sequence of MT-CO2 exhibits several conserved regions that are critical for its function. Studies have shown that specific aromatic residues within this protein are essential for maintaining its structural integrity and functional activity. For instance, tryptophan residues have been identified as crucial for electron transfer efficiency .

Research Findings

Recent genomic studies have provided insights into the evolutionary significance of MT-CO2 in orangutans compared to other primates. Comparative analyses reveal that this gene has undergone specific adaptations in response to environmental pressures, which may influence its function and regulation.

Evolutionary Adaptations

Research indicates that Pongo abelii exhibits unique genetic variations in the MT-CO2 gene compared to other great apes, reflecting its adaptation to a distinct ecological niche . These variations may affect metabolic rates and energy efficiency, which are vital for survival in their natural habitats.

Experimental Studies

Experimental approaches involving recombinant DNA technology have enabled researchers to express and purify MT-CO2 for functional studies. Such studies typically focus on:

  • Enzyme Activity: Assessing the catalytic efficiency of recombinant MT-CO2 in electron transfer processes.

  • Mutagenesis Studies: Investigating how specific mutations in the MT-CO2 gene affect enzyme function and stability.

StudyMethodKey Findings
MutagenesisIdentified critical residues for function; aromatic residues essential for activity.
Comparative GenomicsHighlighted unique adaptations in Pongo abelii; implications for metabolic efficiency.

Implications for Conservation

Understanding the molecular biology of MT-CO2 has broader implications for conservation biology, particularly concerning the Sumatran orangutan's declining populations due to habitat loss and environmental changes. Insights from genetic studies can inform conservation strategies aimed at preserving genetic diversity and enhancing resilience against environmental stressors.

References

  1. The effect of amino acid substitutions in the conserved aromatic regions of cytochrome c oxidase subunit II .

  2. Comparative and demographic analysis of orang-utan genomes .

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
MT-CO2; COII; COX2; COXII; MTCO2; Cytochrome c oxidase subunit 2; Cytochrome c oxidase polypeptide II
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-227
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
MAHAAQVGLQDATSPIMEELVIFHDHALMIIFLICFLVLYALFLTLTTKLTNTSISDAQE METIWTILPAIILILIALPSLRILYLTDEINDPSFTIKSIGHQWYWTYEYTDYGGLIFNS YMLPPLFLEPGDLRLLDVDNRVVLPVEAPVRMMITSQDVLHSWTVPSLGLKTDAIPGRLN QTTFTATRPGVYYGQCSEICGANHSFMPIVLELIPLKIFEMGPVFTL
Uniprot No.

Target Background

Function
Cytochrome c oxidase subunit 2 (MT-CO2) is a component of cytochrome c oxidase (complex IV, CIV), the terminal enzyme in the mitochondrial electron transport chain responsible for oxidative phosphorylation. This chain involves three multi-subunit complexes: succinate dehydrogenase (complex II, CII), ubiquinol-cytochrome c oxidoreductase (complex III, CIII), and cytochrome c oxidase (CIV). These complexes work cooperatively to transfer electrons from NADH and succinate to molecular oxygen, generating an electrochemical gradient across the inner mitochondrial membrane that drives ATP synthesis. Cytochrome c oxidase catalyzes the reduction of oxygen to water. Electrons from reduced cytochrome c in the intermembrane space are transferred through the copper A center (CuA) of subunit 2 and heme A of subunit 1 to the active site (a binuclear center, BNC) comprised of heme A3 and copper B (CuB) in subunit 1. The BNC utilizes four electrons from cytochrome c and four protons from the mitochondrial matrix to reduce molecular oxygen to two water molecules.
Database Links
Protein Families
Cytochrome c oxidase subunit 2 family
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.

Q&A

What is Pongo abelii Cytochrome c oxidase subunit 2 (MT-CO2) and its role in cellular respiration?

MT-CO2 is one of the core subunits of mitochondrial cytochrome c oxidase (COX), directly responsible for the initial transfer of electrons from cytochrome c to the COX complex during cellular respiration. The oxidized form of the cytochrome c heme group transfers electrons to the cytochrome oxidase complex, the final protein carrier in the mitochondrial electron-transport chain, which is crucial for ATP production . As a mitochondrially-encoded protein, MT-CO2 contains a dual core CuA active site that plays a significant role in the physiological electron transfer process .

The full-length Pongo abelii MT-CO2 protein consists of 227 amino acids with a sequence that begins with MAHAAQVGLQDATSPIMEELVI and continues through to PLKIFEMGPVFTL at the C-terminus . This protein is highly conserved across species but shows specific adaptations in the orangutan lineage.

How does recombinant MT-CO2 protein quality affect experimental outcomes?

The quality of recombinant MT-CO2 protein significantly impacts experimental reliability. High-quality preparations typically achieve >90% purity as determined by SDS-PAGE analysis . When designing experiments, researchers should consider:

Quality ParameterAcceptable RangeImpact on Experiments
Purity>90% by SDS-PAGEMinimizes interference from contaminating proteins
Endotoxin level<1 EU/µgPrevents inflammatory responses in cell-based assays
Proper foldingConfirmed by activity assaysEnsures functional relevance of the protein
Storage stabilityStable at -20°C/-80°CMaintains consistent experimental conditions

For optimal results, the protein should be reconstituted in deionized sterile water to 0.1-1.0 mg/mL, with 5-50% glycerol added for long-term storage. Working aliquots should be stored at 4°C for no more than one week to prevent activity loss from repeated freeze-thaw cycles .

What expression systems are used for producing recombinant Pongo abelii MT-CO2?

Escherichia coli remains the most common expression system for producing recombinant Pongo abelii MT-CO2 protein . The methodology typically includes:

  • Subcloning the MT-CO2 gene into a suitable expression vector (such as pET systems)

  • Transforming the construct into an E. coli expression strain (e.g., BL21(DE3) or Transetta(DE3))

  • Inducing protein expression using IPTG

  • Lysing cells and purifying the protein using affinity chromatography (typically via His-tag)

While E. coli expression is efficient, it's important to note that as a mitochondrial membrane protein, MT-CO2 may lack certain post-translational modifications in bacterial systems. For studies requiring these modifications, mammalian or insect cell expression systems may be more appropriate, though they typically yield lower protein amounts.

How can the activity of recombinant MT-CO2 be measured and validated?

Validating the functional activity of recombinant MT-CO2 requires assessing its electron transport capabilities. Several methodological approaches can be employed:

  • Spectrophotometric assays: UV-spectrophotometry can measure the oxidation of reduced cytochrome c, which indicates functional activity of MT-CO2. The decrease in absorbance at 550 nm correlates with cytochrome c oxidation rate .

  • Oxygen consumption measurements: Using oxygen electrodes to measure the rate of oxygen consumption in reconstituted systems containing recombinant MT-CO2.

  • Resonance Raman spectroscopy: This technique can detect structural changes around heme groups that occur during electron transfer, providing insights into the functional state of the protein .

  • Activity reconstitution assays: Incorporating the recombinant protein into liposomes with other COX subunits to measure restored electron transport activity.

Research has shown that recombinant cytochrome c oxidase subunits can directly integrate into purified complexes and increase activity, with some preparations showing up to twice the activity of the native complex alone .

What are the comparative differences between MT-CO2 from Pongo abelii and other primate species?

Comparative analysis of MT-CO2 sequences provides valuable insights into primate evolution. Significant observations include:

SpeciesKey Sequence DifferencesPotential Functional Implications
Pongo abeliiMAHAAQVGLQDATSPIMEELVIFHDHALMIIFLICFLVLYALFLTLTTK...Specific adaptations to Sumatran orangutan physiology
Pongo pygmaeusMAHRAQVGLQDATSPIMEELVIFHDHALMIIFLICFLVLYALFLTLTTK...H/A variation at position 3 compared to P. abelii
Homo sapiensSimilar but with distinct variationsReflects evolutionary divergence between humans and orangutans

Interpopulation divergence at the MT-CO2 locus can reach nearly 20% at the nucleotide level between some species, including numerous nonsynonymous substitutions . These variations may reflect adaptations to different environmental conditions or metabolic demands. Studies suggest that approximately 4% of the sites in the MT-CO2 gene evolve under relaxed selective constraint (ω = 1), while the majority are under strong purifying selection (ω << 1) .

What structural features are critical for MT-CO2 function and interaction with other components?

Several key structural features determine MT-CO2 functionality:

  • CuA binding site: The dual core CuA active site is essential for accepting electrons from cytochrome c and transferring them within the oxidase complex .

  • Transmembrane domains: MT-CO2 contains hydrophobic regions that anchor it within the inner mitochondrial membrane.

  • Interaction interfaces: Specific amino acid residues facilitate binding to other subunits of the COX complex and to cytochrome c.

  • Heme interaction sites: Regions that interact with heme groups are crucial for electron transfer capabilities.

Research using resonance Raman analysis has revealed that protein partners can cause structural changes around heme a in the COX complex, influencing the active center and enhancing enzymatic activity . These interactions are highly specific and sensitive to amino acid substitutions, explaining why MT-CO2 sequences are generally well conserved despite some adaptive variation.

How can recombinant MT-CO2 be used to study evolutionary divergence in primates?

Recombinant MT-CO2 proteins from different primate species provide powerful tools for studying molecular evolution. Methodological approaches include:

  • Comparative functional studies: Expressing MT-CO2 from different primate species and comparing their enzymatic activities under standardized conditions can reveal functional consequences of evolutionary changes.

  • Hybrid complex formation: Mixing recombinant MT-CO2 from one species with COX components from another can identify compatibility issues that reflect evolutionary constraints.

  • Structure-function relationship analysis: Site-directed mutagenesis can be used to introduce specific amino acid changes observed between species to pinpoint functionally significant variations.

Studies of the marine copepod Tigriopus californicus have shown that despite MT-CO2's integral role in electron transport, extensive intraspecific nucleotide and amino acid variation exists between populations . Similar approaches could illuminate primate evolution. The orang-utan genome project has already provided valuable data on genetic diversity between Bornean and Sumatran orangutans, with implications for understanding selective pressures on mitochondrial genes .

What methodologies can address the challenges in expressing functional MT-CO2 in heterologous systems?

Expressing functional mitochondrial membrane proteins like MT-CO2 presents several challenges that can be addressed through methodological refinements:

  • Optimized codon usage: Adapting the MT-CO2 gene codons to match the expression host's preferences improves translation efficiency.

  • Fusion tags selection: Beyond standard His-tags, specialized fusion partners like MBP (maltose-binding protein) can enhance solubility and proper folding.

  • Membrane mimetics: Including detergents or lipids during purification helps maintain native protein conformation.

  • Expression condition optimization: Using multivariate design of experiments (DoE) approaches to systematically test different expression parameters:

ParameterOptimization RangeImpact on Expression
Temperature16-37°CLower temperatures often improve folding
Induction timingOD600 0.4-1.0Optimal cell density affects yield
Inducer concentration0.1-1.0 mM IPTGFinding balance between expression and toxicity
Media compositionVarious formulationsNutrients affect cell growth and protein synthesis

Recent work on recombinant viral vector production demonstrated that five critical parameters significantly affected protein yield: transfection pH, production pH, complexation time, viable cell density at transfection, and transfection reagent to DNA ratio . Similar multivariate approaches could be applied to optimize MT-CO2 expression.

How can structural analysis of MT-CO2 contribute to understanding mitochondrial disease mechanisms?

Structural studies of MT-CO2 provide crucial insights into mitochondrial disease mechanisms through several methodological approaches:

  • Structural determination: X-ray crystallography or cryo-electron microscopy of recombinant MT-CO2 in various states can reveal how disease-associated mutations alter protein conformation.

  • Molecular dynamics simulations: Computational analysis of MT-CO2 structure allows prediction of how specific mutations affect stability and function.

  • Protein-protein interaction mapping: Techniques such as crosslinking mass spectrometry can identify how MT-CO2 interacts with other components of the respiratory chain.

Decreased cytochrome c oxidase activity is frequently observed among patients with mitochondrial diseases . Recombinant proteins enable detailed investigation of disease-associated variants. For example, mutations affecting the interaction between MT-CO2 and cytochrome c might disrupt electron transfer, causing energy production deficiencies characteristic of mitochondrial disorders.

The dual role of cytochrome c in both respiration and apoptosis adds complexity to these studies. When released into the cytosol, cytochrome c binds to Apaf-1, triggering caspase-9 activation and accelerating apoptosis . Understanding how MT-CO2 mutations might influence this process could reveal connections between mitochondrial dysfunction and cell death pathways in disease states.

What techniques can characterize the interaction between MT-CO2 and other components of the respiratory chain?

Several advanced techniques can characterize the molecular interactions between MT-CO2 and its partner proteins:

  • Surface plasmon resonance (SPR): Quantifies binding kinetics between immobilized MT-CO2 and solution-phase partners like cytochrome c.

  • Isothermal titration calorimetry (ITC): Provides thermodynamic parameters of binding interactions.

  • Förster resonance energy transfer (FRET): Measures proximity between fluorescently labeled MT-CO2 and interaction partners in real-time.

  • Hydrogen-deuterium exchange mass spectrometry (HDX-MS): Identifies regions of MT-CO2 that undergo conformational changes upon binding to partners.

  • Molecular docking combined with site-directed mutagenesis: Computational prediction followed by experimental validation can identify specific interaction residues. For example, allyl isothiocyanate (AITC) has been shown to form a 2.9 Å hydrogen bond with Leu-31 in a related cytochrome c oxidase subunit .

Research has demonstrated that Higd1a, a hypoxia-inducible protein, can directly integrate into CcO and increase its activity by causing structural changes around heme a . Similar interaction studies with orangutan MT-CO2 could reveal species-specific regulatory mechanisms.

How can recombinant MT-CO2 contribute to conservation research for endangered orangutans?

Recombinant MT-CO2 provides valuable tools for orangutan conservation research:

  • Population genetics: MT-CO2 sequence variations can serve as markers for population structure and genetic diversity assessment in wild orangutans.

  • Metabolic adaptation studies: Functional analysis of MT-CO2 variants can reveal adaptations to different habitats and diets between Sumatran (Pongo abelii) and Bornean (Pongo pygmaeus) orangutans.

  • Health biomarker development: Understanding MT-CO2 function could help develop biomarkers for health assessment in captive orangutan populations.

Comparative genomic studies have shown that despite high conservation of MT-CO2 due to its crucial role, there are distinct differences between Sumatran and Bornean orangutans . These differences may reflect adaptations to their specific environmental challenges and could inform conservation strategies aimed at preserving genetic diversity.

What emerging technologies could enhance the study of recombinant MT-CO2 function?

Several cutting-edge technologies show promise for advancing MT-CO2 research:

  • Cryo-electron microscopy: Achieving near-atomic resolution of MT-CO2 within the complete COX complex without the need for crystallization.

  • Single-molecule techniques: Observing individual MT-CO2 molecules during electron transfer events to capture transient states.

  • Nanoscale biosensors: Developing MT-CO2-based biosensors for monitoring electron transport activity in real-time.

  • CRISPR-Cas9 genome editing: Creating precise mutations in cellular MT-CO2 to study effects in their native environment.

  • AI-driven protein design: Computational approaches to design optimized MT-CO2 variants with enhanced stability or activity for biotechnological applications.

Recent developments in multivariate optimization approaches used for recombinant adeno-associated viral vector production demonstrate how these methods could be applied to enhance MT-CO2 expression and functionality studies . Such approaches could accelerate research into this important mitochondrial protein's role in primate evolution and disease.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.