Recombinant Pongo abelii Cytochrome P450 4V2 (CYP4V2)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Structure

The CYP4V2 gene spans 21 kb and consists of 11 exons that encode a 525 amino acid protein . The CYP4V2 protein is predicted to have a transmembrane segment at the amino-terminal end linked to a globular domain .

Function

CYP4V2 is a PUFA $$ \omega $$ hydroxylase that is highly expressed in the transformed human RPE cell line ARPE-19 . It is involved in the $$ \omega $$-hydroxylation of fatty acids, particularly long-chain polyunsaturated fatty acids (PUFAs) . Abnormalities in $$ \omega \3) PUFAs and their metabolism have been observed in patients with Bietti's crystalline dystrophy (BCD) .

Role in Disease

Mutations in the CYP4V2 gene are associated with Bietti's crystalline dystrophy (BCD), a rare autosomal recessive disorder characterized by yellow-white crystals in the retina, RPE, and cornea, leading to progressive visual loss .

Mutations in CYP4V2

Over 129 variants of CYP4V2 have been identified . These mutations include missense, nonsense, indel, deletion, and splice site mutations .

Examples of CYP4V2 Mutations:

  • IVS6-8del17bp/insGC: A common mutation in East Asian populations, which is a 3' splicing acceptor site change expected to cause an in-frame deletion of 62 amino acid-encoding exon 7 .

  • Y219H, W244X, D324V, P396L, and R400C: Five novel mutations identified in Chinese patients with BCD .

  • L22V, R287T, and G410C: Three novel variants identified in healthy subjects, studied for their functional consequences .

  • R36S, Q259K, and H331P: Previously reported variants, also studied for their functional consequences .

  • R320X: A mutation that results in a premature stop codon, leading to the loss of approximately 33% of the C-terminal portion of the protein .

  • R452H: A mutation where histidine is substituted with arginine .

Functional Characterization of CYP4V2 Variants

Functional studies have been conducted to characterize the impact of CYP4V2 genetic variants on enzyme activity. For example, six protein-coding variants (L22V, R287T, G410C, R36S, Q259K, and H331P) were studied by cloning cDNA sequences encoding each amino acid variant and the wild-type CYP4V2 protein into expression vectors, followed by transfection into eukaryotic 293T cells for overexpression .

Conservation of Amino Acids

Amino acid sequence alignment of the CYP4V2 protein across different species reveals highly conserved regions, indicating their importance for the protein's function .

Impact of Mutations on Protein Structure and Function

Bioinformatics tools such as Mutation Taster, CADD, PROVEAN, PolyPhen-2, and SIFT are used to analyze the potential impact of mutations on the function of CYP4V2 . Mutations can affect the structure and stability of the protein, potentially altering heme coordination and local isoelectric points .

Genotype-Phenotype Correlation

Studies have explored the genotype-phenotype association in patients with BCD, but the correlation between specific mutations and the severity of the disease is not always clear . Clinical variability within and between families can be high, and some mutations are predicted to result in a complete absence of CYP4V2 function .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for custom preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
CYP4V2; Cytochrome P450 4V2; Docosahexaenoic acid omega-hydroxylase CYP4V2; Long-chain fatty acid omega-monooxygenase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-525
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
MAGLWLGLVWQKLLLWGAASAVSLAGASLVLSLLQRVASYARKWQQMRPIPTVARAYPLV GHALLMKRDGREFFQQIIEYTEEYRHMPLLKLWVGPVPMVALYNAENVEVILTSSRQIDK SSMYKFLEPWLGLGLLTSTGNKWRSRRKMLTPTFHFTILEDFLDIMNEQANILVKKLEKH VNQEAFNCFFYITLCALDIICETAMGKNIGAQSNDDSEYVRAVYRMSQMIFQRIKMPWLW LDLWYLMFKEGWEHEKGLKILHTFTNNVIAERANEMNADEDCRGVGRGSAPSKNKRRAFL DLLLSVTDDEGNRLSHEDIREEVDTFMFEGHDTTAAAINWSLYLLGCNPEVQQKVDHELD DVFGKSDRPATVEDLKKLRYLECVIKETLRLFPSVPLFARSVSEDCEVAGYRVLKGTEAV IIPYALHRDPRYFPNPEEFQPERFFPENAQGRHPYAYVPFSAGPRNCIGQKFAVMEEKTI LSCILRHFWIESNQKREELGLEGQLILRPSNGIWIKLKRRDADEP
Uniprot No.

Target Background

Function

Recombinant Pongo abelii Cytochrome P450 4V2 (CYP4V2) is a cytochrome P450 monooxygenase involved in ocular fatty acid metabolism. It catalyzes the ω-hydroxylation of polyunsaturated fatty acids (PUFAs), including docosahexaenoate (DHA) and its precursor eicosapentaenoate (EPA), contributing to retinal PUFA homeostasis. CYP4V2 also ω-hydroxylates saturated fatty acids such as laurate, myristate, and palmitate, exhibiting higher catalytic efficiency with myristate, followed by laurate and then palmitate (C14 > C12 > C16). Mechanistically, it utilizes molecular oxygen, incorporating one oxygen atom into the substrate and reducing the second to water. The required two electrons are provided by NADPH via cytochrome P450 reductase (CPR; NADPH-ferrihemoprotein reductase).

Database Links
Protein Families
Cytochrome P450 family
Subcellular Location
Endoplasmic reticulum membrane; Single-pass membrane protein.

Q&A

What is Cytochrome P450 4V2 (CYP4V2) and what is its function in Pongo abelii?

Cytochrome P450 4V2 (CYP4V2) is a member of the cytochrome P450 enzyme family, specifically belonging to the CYP4 subfamily known for omega oxidation of endogenous fatty acids. In Pongo abelii (Sumatran orangutan), as in humans, CYP4V2 is involved in lipid metabolism and plays a critical role in the maintenance of cellular lipid homeostasis, particularly in the retinal pigment epithelium (RPE) cells . The protein consists of 525 amino acids in its full-length form and contains the characteristic heme-binding domain essential for its enzymatic function . CYP4V2 catalyzes the oxidation of various fatty acid substrates, which is crucial for preventing the accumulation of toxic lipid species in cells. Mutations in the CYP4V2 gene are associated with Bietti's Crystalline Dystrophy (BCD) in humans, suggesting evolutionary conservation of function across primates .

How does recombinant CYP4V2 from Pongo abelii differ structurally and functionally from human CYP4V2?

Recombinant Pongo abelii CYP4V2 shares significant sequence homology with human CYP4V2, reflected in the UniProt entry Q5RCN6 for the orangutan protein . While both enzymes maintain the core functional domains characteristic of cytochrome P450 enzymes, including the heme-binding region, substrate recognition sites, and electron transfer interfaces, subtle species-specific differences exist in their amino acid sequences. These differences may result in altered substrate specificity profiles and catalytic efficiencies.

What are the optimal expression systems for recombinant Pongo abelii CYP4V2 production?

The optimal expression of recombinant Pongo abelii CYP4V2 can be achieved using several expression systems, each with distinct advantages depending on research objectives:

Bacterial Expression Systems:

  • E. coli expression systems, particularly specialized strains like Topp3 or DH5α transformed with chaperone plasmids (e.g., pGro7 encoding groES-groEL chaperones), have been successfully employed for CYP4V2 expression .

  • N-terminally modified constructs similar to those described by Wang and colleagues have shown improved expression levels in bacterial systems .

  • Key considerations include using N-terminal truncation (Δ3–20) and C-terminal His-tagging to enhance solubility and facilitate purification .

Insect Cell Systems:

  • Insect cell microsomes containing recombinant NADPH-cytochrome P450 reductase (CPR) provide a more native-like membrane environment for functional studies of CYP4V2 .

  • This system allows for incorporation of purified CYP4V2 into microsomes, yielding catalytically competent preparations that better mimic the protein's natural environment .

Mammalian Cell Systems:

  • Human cell lines provide the most physiologically relevant post-translational modifications and membrane composition.

  • iPSC-derived systems allow for expression in relevant cellular contexts, such as retinal pigment epithelium cells, which are affected in Bietti's Crystalline Dystrophy .

The selection of an expression system should be guided by experimental objectives, with bacterial systems favored for structural studies requiring high protein yields, and eukaryotic systems preferred for functional and interaction studies .

What are the critical steps for successful purification of recombinant CYP4V2 with maintained enzymatic activity?

Successful purification of recombinant CYP4V2 with preserved enzymatic activity requires careful attention to several critical steps:

Initial Cell Lysis and Membrane Solubilization:

  • Treatment with lysozyme followed by sonication in buffer containing protective agents (e.g., 3 mM TCEP, 1 mM PMSF, 10 μM leupeptin, 700 mM KCl, 20% v/v glycerol) is essential for initial cell disruption .

  • Membrane solubilization using mild detergents such as CHAPS (0.86%) with continuous stirring (3-4 hours at 4°C) helps extract the protein while maintaining its native conformation .

Chromatographic Purification:

  • Affinity chromatography using the His-tag (if incorporated) provides the initial purification step.

  • Ion exchange and size exclusion chromatography further enhance purity.

  • Throughout purification, maintaining a buffer environment containing glycerol (20%) and reducing agents helps preserve protein stability and activity.

Activity Preservation Measures:

  • Incorporation of purified CYP4V2 into microsomes containing CPR is crucial for functional studies.

  • Assessment of heme incorporation using CO-difference spectra confirms proper protein folding and active site integrity.

  • Storage in buffer containing glycerol at -80°C with minimization of freeze-thaw cycles.

The success of purification can be monitored by measuring the specific content of CYP4V2 using the CO-difference spectral assay and by assessing the protein's ability to metabolize known substrates in reconstituted systems .

What are the established assays for measuring CYP4V2 enzymatic activity in vitro?

Several established assays can effectively measure CYP4V2 enzymatic activity in vitro:

Substrate Depletion Assays:

  • Monitoring the disappearance of known fatty acid substrates using LC-MS/MS.

  • This approach has been successfully applied to cytochrome P450 enzymes, showing improved sensitivity compared to traditional methods .

  • Intrinsic clearance (CLint) determination through substrate depletion provides quantitative measures of enzyme activity .

Metabolite Formation Analysis:

  • Identification and quantification of hydroxylated fatty acid products using LC-MS/MS.

  • Simultaneous determination of substrate depletion and metabolite formation profiles enables comprehensive characterization of CYP4V2 catalytic properties .

Spectroscopic Analysis:

  • UV-visible spectroscopy to monitor the characteristic absorbance changes during catalytic cycling.

  • CO-difference spectroscopy to confirm proper heme incorporation and protein folding.

Reconstituted Systems:

  • CYP4V2 incorporated into microsomes containing NADPH-cytochrome P450 reductase provides a physiologically relevant environment for activity measurements .

  • These systems allow for precise control of enzyme concentration and composition, facilitating mechanistic studies .

For quantitative assessment of enzymatic parameters, researchers typically measure initial reaction rates across varying substrate concentrations to determine Km and Vmax values. The most reliable correlations have been observed when comparing in vivo CLint with in vitro CLint determined using relative activity factors and adjusted for nonspecific binding .

How can researchers accurately evaluate CYP4V2-substrate interactions and determine kinetic parameters?

Accurate evaluation of CYP4V2-substrate interactions and determination of kinetic parameters requires a systematic approach:

Substrate Specificity Profiling:

  • Screen potential substrates using in vitro assays with purified recombinant CYP4V2.

  • Confirm metabolism through detection of specific metabolites using LC-MS/MS.

  • Compare activity across multiple substrates to establish specificity profiles.

Kinetic Parameter Determination:

  • Measure initial reaction rates at varying substrate concentrations (typically spanning 0.1-10 times Km).

  • Fit data to appropriate enzyme kinetic models (Michaelis-Menten, Hill, or substrate inhibition equations).

  • For accurate intrinsic clearance (CLint) determination, incorporate corrections for:

    • Nonspecific binding to assay components

    • Fraction unbound in the experimental system

    • Differences between recombinant systems and native environments using relative activity factors

Binding Affinity Measurements:

  • Use spectral binding titrations to determine dissociation constants (Kd).

  • Apply isothermal titration calorimetry (ITC) for thermodynamic characterization of binding events.

  • Employ surface plasmon resonance (SPR) for real-time binding kinetics.

For translating in vitro findings to physiological relevance, researchers should compare data from recombinant CYP4V2 with human liver microsomes (HLMs) using the relative activity approach. This provides more reliable predictions than the relative abundance approach when bridging between recombinant enzymes and HLMs .

How is recombinant CYP4V2 used in modeling Bietti's Crystalline Dystrophy (BCD)?

Recombinant CYP4V2 plays a crucial role in modeling Bietti's Crystalline Dystrophy (BCD) through multiple complementary approaches:

Patient-Derived iPSC Models:

  • Induced pluripotent stem cell-derived retinal pigment epithelium (iRPE) cells from BCD patients provide disease-relevant cellular models .

  • These models retain patient-specific mutations and demonstrate phenotypes including vulnerability to blue light-induced oxidative stress .

  • Key biomarkers for quantifying cellular phenotypes include:

    • Reactive oxygen species (ROS) levels

    • 4-hydroxy 2-nonenal (4-HNE) levels (a marker of lipid peroxidation)

    • Cell death rates following oxidative stress exposure

Recombinant CYP4V2 for Functional Studies:

  • Wild-type recombinant CYP4V2 serves as a control for comparing enzymatic activity with mutant variants.

  • Introduction of specific BCD-associated mutations into recombinant CYP4V2 enables structure-function relationship studies.

  • Comparative analysis of wild-type and mutant protein stability, substrate binding, and catalytic efficiency provides insights into pathogenic mechanisms.

Gene Therapy Evaluation Systems:

  • AAV-mediated delivery of functional CYP4V2 to BCD patient-derived cells demonstrates therapeutic potential .

  • Significant reduction in light-induced cell death has been observed following gene therapy treatment .

  • The system reveals genotype-phenotype correlations and personalized responses to therapeutic interventions, highlighting the value of precision medicine approaches .

These models collectively demonstrate that CYP4V2 dysfunction leads to disrupted lipid metabolism, accumulation of toxic lipid species, increased oxidative stress sensitivity, and eventual RPE degeneration characteristic of BCD .

What role does CYP4V2 play in AAV-mediated gene therapy approaches for retinal diseases?

CYP4V2 has emerged as a critical target for AAV-mediated gene therapy approaches for retinal diseases, particularly Bietti's Crystalline Dystrophy (BCD):

Therapeutic Mechanism:

  • AAV-CYP4V2 gene therapy provides functional CYP4V2 to compensate for mutated or deficient endogenous protein in retinal pigment epithelium (RPE) cells .

  • The restored CYP4V2 function normalizes lipid metabolism and reduces the accumulation of toxic lipid species that contribute to RPE damage.

  • This approach addresses the root cause of BCD rather than merely treating symptoms .

Preclinical Evidence:

  • Proof-of-concept studies have demonstrated that AAV-CYP4V2 gene therapy can significantly reduce light-induced cell death in BCD patient-derived iPSC-RPE cells .

  • The therapy shows efficacy in protecting RPE cells from oxidative stress, a key pathological mechanism in BCD progression .

Personalized Response Considerations:

  • Significant variability in cellular phenotypes has been observed among iPSC-RPE cells from BCD patients with different mutations .

  • Patient-specific cells retain personalized responses to AAV-mediated gene therapy, highlighting the importance of individualized approaches .

  • This variability suggests that therapy optimization may need to account for specific mutations and genetic backgrounds .

Delivery Optimization:

  • AAV serotype selection is critical for efficient transduction of RPE cells.

  • Promoter choice affects the level and specificity of CYP4V2 expression.

  • Dose-response relationships must be established to determine optimal therapeutic windows.

This approach sets a precedent for precision medicine in retinal diseases, emphasizing the necessity for personalization in therapy development to accommodate individual diversity in disease manifestation and treatment response .

How do researchers investigate CYP4V2 interactions with other cytochrome P450 enzymes?

Researchers employ several sophisticated techniques to investigate CYP4V2 interactions with other cytochrome P450 enzymes:

Luminescence Resonance Energy Transfer (LRET):

  • This technique allows detection of P450-P450 interactions using labeled proteins incorporated into microsomes .

  • LRET can detect both homo-oligomerization of CYP4V2 and heteromeric complexes formation with other P450 enzymes such as CYP2E1 and CYP3A4 .

  • The approach can be applied in both model systems (insect cell microsomes) and human liver microsomes to validate physiological relevance .

Co-Incorporation into Microsomal Membranes:

  • Purified CYP4V2 can be incorporated alongside other P450 enzymes into microsomes containing NADPH-cytochrome P450 reductase .

  • This system allows controlled variation in the composition and concentration of the P450 ensemble .

  • By altering the ratio of different P450 enzymes, researchers can study concentration-dependent interaction effects .

Functional Effect Analysis:

  • Changes in substrate metabolism kinetics when multiple P450 enzymes are present together compared to individual enzymes.

  • Alterations in regioselectivity or product profiles can indicate functional interactions.

  • The impact of specific substrates or inhibitors on these interactions provides mechanistic insights .

Modulation Studies:

  • Investigation of how drugs or substrates affect P450-P450 interactions reveals functional cross-talk mechanisms .

  • For example, studies have shown that MDMA (a CYP2D6 substrate) can significantly modulate interactions between CYP2D6 and other P450 enzymes like CYP2E1 .

These approaches collectively contribute to understanding the "systems biology" of the P450 ensemble, moving beyond isolated enzyme studies to comprehend how the integrated multienzyme system functions in the cellular environment .

What computational models exist for predicting CYP4V2 structure and substrate interactions?

Several computational approaches have been developed to predict CYP4V2 structure and substrate interactions:

Homology Modeling:

  • CYP4V2 structure can be predicted using homology modeling based on crystallographic structures of related cytochrome P450 enzymes.

  • The models incorporate conserved structural features including the heme-binding region, I-helix, and substrate recognition sites.

  • Validation typically involves energy minimization and comparison with experimental data on substrate binding and metabolism.

Molecular Docking Studies:

  • Docking algorithms predict binding modes and affinities of potential substrates within the CYP4V2 active site.

  • These studies help identify key amino acid residues involved in substrate recognition and positioning.

  • Integration with site-directed mutagenesis experimental data strengthens predictive reliability.

Molecular Dynamics Simulations:

  • MD simulations reveal dynamic aspects of CYP4V2-substrate interactions and conformational changes during the catalytic cycle.

  • These simulations can incorporate membrane environments to better mimic the native protein context.

  • Analysis of simulation trajectories provides insights into substrate access channels and product egress pathways.

Quantitative Structure-Activity Relationship (QSAR) Models:

  • QSAR models correlate molecular properties of substrates with their binding affinities or metabolic rates.

  • These models help predict novel substrates and inhibitors based on structural similarities.

  • Machine learning approaches have enhanced predictive power by incorporating large datasets of known P450-substrate interactions.

The integration of these computational approaches with experimental data from recombinant enzyme systems provides a powerful framework for understanding CYP4V2 function and developing therapeutic strategies for related diseases like Bietti's Crystalline Dystrophy.

How can researchers leverage CYP4V2 in drug metabolism and pharmacokinetic studies?

Researchers can strategically leverage CYP4V2 in drug metabolism and pharmacokinetic studies through several sophisticated approaches:

Metabolic Clearance Prediction:

  • Recombinant CYP4V2 can be incorporated into in vitro drug metabolism systems to assess its contribution to the clearance of candidate drugs, particularly those with lipophilic structures .

  • The drug depletion method using recombinant enzymes offers improved assay sensitivity compared with human liver microsomes and cryopreserved hepatocytes for intrinsic clearance (CLint) determination .

  • For accurate predictions, researchers should:

    • Apply relative activity factors (RAFs) rather than relative abundance approaches

    • Adjust for nonspecific binding

    • Incorporate fraction unbound in blood when calculating in vivo CLint using the parallel-tube model

Drug-Drug Interaction Assessment:

  • CYP4V2's potential interactions with other P450 enzymes can influence drug metabolism profiles, particularly for compounds metabolized by multiple P450 enzymes .

  • Studies of heteromeric complex formation between CYP4V2 and other P450 enzymes provide insights into functional cross-talk that may affect drug clearance .

  • Modulation of these interactions by specific drugs may lead to unexpected pharmacokinetic profiles .

Pharmacogenetic Considerations:

  • Genetic variants in CYP4V2 identified in different populations may impact drug metabolism.

  • Patient-specific iPSC-derived models containing different CYP4V2 variants can help predict individualized drug responses .

  • This approach supports precision medicine initiatives by accounting for genetic diversity in drug metabolism pathways.

What are the challenges and solutions in scaling up recombinant CYP4V2 production for research applications?

Scaling up recombinant CYP4V2 production for research applications presents several challenges along with their corresponding solutions:

Challenge 1: Low Expression Yields

  • Solutions:

    • Optimization of expression constructs with N-terminal modifications (truncation of hydrophobic segments) and C-terminal tags .

    • Co-expression with molecular chaperones (e.g., groES-groEL) to improve folding efficiency .

    • Implementation of specialized E. coli strains designed for membrane protein expression.

    • Exploration of alternative expression systems such as insect cells for improved yield and functionality.

Challenge 2: Proper Heme Incorporation

  • Solutions:

    • Supplementation of growth media with δ-aminolevulinic acid as a heme precursor.

    • Controlled expression at lower temperatures (16-20°C) to allow proper folding and heme incorporation.

    • Development of spectroscopic assays to monitor heme incorporation during the production process.

Challenge 3: Maintaining Enzymatic Activity During Purification

  • Solutions:

    • Selection of mild detergents (e.g., CHAPS at 0.86%) for membrane solubilization .

    • Inclusion of stabilizing agents (glycerol, reducing agents) throughout the purification process.

    • Implementation of buffer systems optimized for CYP4V2 stability.

    • Rapid purification protocols to minimize exposure to potentially denaturing conditions.

Challenge 4: Quality Control for Functional Studies

  • Solutions:

    • Implementation of CO-difference spectroscopy to verify intact heme-binding sites.

    • Development of standardized activity assays with well-characterized substrates.

    • Validation of recombinant CYP4V2 function through comparison with native enzyme in human liver microsomes .

    • Application of techniques like luminescence resonance energy transfer (LRET) to verify proper protein-protein interactions .

Challenge 5: Batch-to-Batch Reproducibility

  • Solutions:

    • Establishment of standardized production protocols with defined quality control metrics.

    • Development of reference standards for activity and spectral properties.

    • Implementation of automated expression and purification systems to minimize human error.

By addressing these challenges systematically, researchers can achieve reliable and scalable production of functional recombinant CYP4V2 for various research applications, from basic enzymatic characterization to therapeutic development for conditions like Bietti's Crystalline Dystrophy .

What are the latest advancements in understanding CYP4V2 function in lipid metabolism?

Recent advancements have significantly expanded our understanding of CYP4V2's function in lipid metabolism:

Substrate Specificity Refinement:

  • New research has clarified that CYP4V2, as a member of the CYP4 family, specializes in the omega oxidation of endogenous fatty acids .

  • Studies using recombinant CYP4V2 have identified specific medium and long-chain fatty acids as preferred substrates.

  • The enzyme shows particular activity toward omega-hydroxylation of these substrates, converting them to more water-soluble metabolites for elimination.

Role in Retinal Lipid Homeostasis:

  • Advanced studies using patient-derived iPSC-RPE cells have revealed that CYP4V2 plays a critical role in maintaining lipid homeostasis specifically in retinal pigment epithelium .

  • CYP4V2 deficiency leads to accumulation of toxic lipid species that increase vulnerability to oxidative stress, particularly blue light-induced damage .

  • This mechanism explains the selective retinal degeneration observed in Bietti's Crystalline Dystrophy patients.

Oxidative Stress Connection:

  • Recent findings demonstrate that CYP4V2 dysfunction results in elevated levels of reactive oxygen species (ROS) and 4-hydroxy 2-nonenal (4-HNE), a marker of lipid peroxidation .

  • This establishes a direct link between aberrant lipid metabolism due to CYP4V2 mutations and oxidative damage to cellular components.

  • The discovery provides new biomarkers for quantifying disease progression and therapeutic response .

Membrane Interaction Dynamics:

  • Advanced biophysical studies have begun to elucidate how CYP4V2 interacts with membrane lipids to access its hydrophobic substrates.

  • These interactions may be critical for the enzyme's substrate specificity and catalytic efficiency.

These findings collectively enhance our understanding of CYP4V2's physiological role and provide mechanistic insights into how its dysfunction leads to disease, particularly in the context of retinal degeneration .

How might CRISPR-Cas9 technology be applied to study CYP4V2 function and develop therapeutics?

CRISPR-Cas9 technology offers powerful approaches for studying CYP4V2 function and developing therapeutics:

Precise Genetic Modeling:

  • CRISPR-Cas9 enables creation of isogenic cell lines differing only in CYP4V2 status, providing ideal experimental controls.

  • Introduction of specific BCD-associated mutations into wild-type cells allows systematic investigation of mutation-specific effects.

  • Conversion of patient-derived cells with CYP4V2 mutations back to wild-type confirms causality and validates therapeutic approaches.

Functional Domain Mapping:

  • Targeted modification of specific domains within CYP4V2 (substrate recognition sites, heme-binding region, membrane-interaction motifs) can reveal their contributions to enzyme function.

  • Creation of chimeric proteins combining domains from different CYP4 family members helps identify regions responsible for substrate specificity.

  • Introduction of fluorescent or affinity tags at specific positions enables tracking of protein localization and interactions.

Therapeutic Development:

  • CRISPR-Cas9 can be used to correct CYP4V2 mutations directly in patient-derived cells as proof-of-concept for gene editing therapies.

  • Comparison with AAV-mediated gene augmentation provides valuable data on relative efficacy and safety of different therapeutic approaches .

  • Development of base editing or prime editing strategies for common BCD mutations offers potential advantages over traditional CRISPR-Cas9 by reducing double-strand break formation.

Regulatory Element Identification:

  • CRISPR interference (CRISPRi) and CRISPR activation (CRISPRa) techniques can identify regulatory elements controlling CYP4V2 expression.

  • These findings may reveal alternative therapeutic strategies focused on enhancing expression of remaining functional CYP4V2 in patients with partial loss-of-function mutations.

High-Throughput Screening:

  • CRISPR screens can identify genetic modifiers of CYP4V2 function, revealing potential alternative therapeutic targets.

  • Identification of genes that, when modified, can compensate for CYP4V2 deficiency may provide novel treatment approaches beyond direct gene replacement.

These CRISPR-based approaches complement the current AAV-mediated gene therapy strategies being developed for BCD, potentially expanding the therapeutic options available for patients with CYP4V2-associated disorders .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.