Recombinant Pongo abelii DnaJ homolog subfamily C member 22 (DNAJC22)

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant DNAJC22

DNAJC22 belongs to the DnaJ/Hsp40 protein family, which regulates Hsp70 chaperone activity during protein folding and stress responses . The recombinant form is synthesized using E. coli expression systems, enabling high-purity yields for experimental use . Key features include:

PropertyDetails
Host OrganismPongo abelii (Sumatran orangutan)
Expression SystemE. coli with N-terminal His tag
Protein LengthFull-length (1-341 amino acids)
Molecular Weight~39 kDa (calculated from sequence)
Purity≥90% (SDS-PAGE verified)
Storage Conditions-20°C/-80°C in Tris/PBS buffer with 6% trehalose
ReconstitutionDeionized water, with optional glycerol for long-term storage

Production and Quality Control

Recombinant DNAJC22 is optimized for reproducibility:

ParameterSpecification
Expression VectorCustom-designed plasmids for high-yield E. coli expression
Purification MethodAffinity chromatography (His tag)
Endotoxin LevelsNot explicitly stated; typical for E. coli-expressed proteins
LyophilizationStabilized in Tris/PBS buffer with trehalose
StabilityAvoid repeated freeze-thaw cycles; working aliquots stable at 4°C

Research Applications

This recombinant protein is utilized in:

  • Comparative genomics: Studying primate-specific adaptations in protein folding mechanisms .

  • Structural studies: Analyzing DnaJ/Hsp40 family conformational dynamics .

  • Biomarker discovery: Investigating DNAJC22’s role in stress-related diseases .

Recent findings:

  • The Pongo abelii genome shows fewer structural rearrangements and slower Alu repeat activity compared to humans, suggesting stable evolutionary pressure on DNAJC22 .

  • Species-specific variants in DNAJC22 may underlie metabolic differences between Sumatran and Bornean orangutans .

Future Directions

Ongoing research aims to:

  • Resolve DNAJC22’s 3D structure to elucidate chaperone binding interfaces.

  • Validate its interactions in primate cell lines using co-IP and yeast two-hybrid assays .

  • Explore its role in neurodegenerative diseases linked to protein misfolding .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request if possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form typically has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
DNAJC22; DnaJ homolog subfamily C member 22
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-341
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
DNAJC22
Target Protein Sequence
MAKGLLVTYALWAVGGPAGLHHLYLGRDSHALLWMLTLGGGGLGWLWEFWKLPSFVAQAN RAQGQRQSPRGVTPPLSPIRFAAQVIVGIYFGLVALISLSSMVNFYIVALPLAVGLGVLL VAAVGNQTSDFKNTLGAAFLTSPIFYGRPIAILPISVAASITAQKRRRYKALVASEPLSV RLYRLGLAYLAFTGPLAYSALCNTAATLSYVAETFGSFLNWFSFFPLLGRLMEFVLLLPY RIWRLLMGETGFNSSYFQEWAKLYEFVHSFQDEKRQLAYQVLGLSEGATNEEIHRSYREL VKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKPRGSRR
Uniprot No.

Target Background

Function
Recombinant Pongo abelii DnaJ homolog subfamily C member 22 (DNAJC22) may function as a co-chaperone.
Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How is DNAJC22 classified within the heat shock protein family, and what are its conserved domains?

DNAJC22 belongs to the DnaJ heat shock protein family (Hsp40), specifically subfamily C. The classification of DnaJ proteins is based on the presence or absence of three characteristic domains:

  • J-domain (containing the conserved HPD motif)

  • Zinc-finger domain (CXXCXGXG motif)

  • C-terminal domain

Based on this domain organization, DnaJ proteins are categorized into four groups:

  • Group I: Contains all three domains

  • Group II: Contains J-domain and C-terminal domain (lacks zinc-finger domain)

  • Group III: Contains only the J-domain

  • Group IV: Contains a J-domain lacking the HPD motif (considered DnaJ-like proteins)

DNAJC22 falls into Group III as it primarily contains the J-domain, which is the defining characteristic of this subfamily . The classification into subfamily C indicates its evolutionary relationship within the broader DnaJ protein family, which can be further divided into subfamilies A through F based on sequence homology .

What are the recommended methods for studying DNAJC22 expression patterns across different tissues?

To effectively analyze DNAJC22 expression patterns across tissues, a multi-platform approach is recommended:

  • Transcriptome analysis: Utilize RNA-seq or microarray data from tissue atlases to establish baseline expression patterns. Self-organizing map (SOM) clustering has proven effective for identifying co-expression patterns of DNAJC22 with other genes across tissues and cell types .

  • RT-qPCR validation: Design primers specific to DNAJC22 conserved regions to quantify expression levels in target tissues. For cross-species comparisons, primers should target evolutionarily conserved regions.

  • Western blot analysis: Use specific antibodies against DNAJC22 to confirm protein expression, with appropriate loading controls (GAPDH or β-actin).

  • Immunohistochemistry/immunofluorescence: Visualize tissue-specific localization using validated antibodies against DNAJC22.

  • Single-cell RNA sequencing: For higher resolution of expression patterns at the cellular level within complex tissues.

Data integration across these platforms has revealed that DNAJC22 shows tissue-specific expression patterns, with particularly strong expression in organs where HNF4A is also expressed, suggesting a functional relationship between these factors .

What experimental approaches are most effective for validating the interaction between transcription factors and the DNAJC22 locus?

Based on successful identification of HNF4A as a regulator of DNAJC22, the following integrated approach is recommended:

  • In silico prediction:

    • Utilize multiple algorithms (iRegulon, pcaGoPromoter, TFBIND, PROMO, MATCH) to predict potential transcription factor binding sites in the DNAJC22 promoter region

    • Cross-reference predictions from different tools to identify consensus binding sites

  • ChIP-qPCR:

    • Perform chromatin immunoprecipitation with antibodies against the candidate transcription factor

    • Design primers flanking predicted binding sites

    • Quantify enrichment compared to IgG control and distal genomic regions

  • Reporter assays:

    • Clone the DNAJC22 promoter region containing predicted binding sites into a luciferase reporter construct

    • Test reporter activity in the presence or absence of the transcription factor

    • Create mutant versions of binding sites to confirm specificity

  • Functional validation:

    • Perform knockdown/overexpression of the transcription factor and measure changes in DNAJC22 expression

    • Use CRISPR-Cas9 to edit predicted binding sites and assess impact on expression

This integrated approach successfully identified HNF4A as a major transcriptional regulator of DNAJC22, with functional conservation across species from fruit flies to humans .

How conserved is DNAJC22 across species and what does this suggest about its functional importance?

DNAJC22 demonstrates remarkable evolutionary conservation with single orthologs present across diverse species, suggesting functional importance throughout animal evolution. Comparative analysis indicates:

  • Vertebrate conservation: DNAJC22 is the vertebrate ortholog of Drosophila melanogaster Wurst, a gene essential for tracheal system development in flies .

  • Functional conservation: Experimental evidence confirms that the regulatory relationship between HNF4A and DNAJC22 is conserved across multiple species including mouse, human, fruitfly, and zebrafish, suggesting that both the gene and its regulatory mechanisms are under evolutionary constraint .

  • Domain conservation: The J-domain, which is the defining characteristic of DNAJC22, shows the highest degree of sequence conservation across species.

  • Transcriptional regulation: The binding site for HNF4A in the DNAJC22 locus shows high conservation across species, with the most highly conserved predicted binding site being functionally relevant .

This high degree of conservation suggests that DNAJC22 likely plays a fundamental role in cellular processes that have been maintained throughout animal evolution. The identified function in tracheal development in Drosophila points to potential roles in related developmental or physiological processes in vertebrates, possibly involving epithelial morphogenesis or tubular organ development .

What approaches should be used when comparing DNAJC22 function between Pongo abelii and other primates or model organisms?

When conducting comparative functional analysis of DNAJC22 between Pongo abelii and other species, the following methodological framework is recommended:

  • Sequence alignment and phylogenetic analysis:

    • Perform multiple sequence alignment of DNAJC22 protein sequences across species

    • Construct phylogenetic trees to visualize evolutionary relationships

    • Identify conserved domains and species-specific variations

  • Expression pattern comparison:

    • Compare tissue-specific expression profiles across species using RNA-seq or microarray data

    • Identify tissues with conserved or divergent expression patterns

    • Use self-organizing map (SOM) clustering to identify co-expressed genes across species

  • Regulatory element comparison:

    • Align promoter regions to identify conserved transcription factor binding sites

    • Perform comparative ChIP-seq analysis for key transcription factors (e.g., HNF4A)

    • Test functionality of orthologous regulatory elements using cross-species reporter assays

  • Functional complementation experiments:

    • Test whether Pongo abelii DNAJC22 can rescue phenotypes in model organisms with DNAJC22/Wurst knockout

    • Compare with human or mouse DNAJC22 rescue efficiency

  • Cross-species protein-protein interaction studies:

    • Identify conserved interaction partners using affinity purification-mass spectrometry

    • Compare interactomes between species to identify core conserved functions

The strong conservation of the regulatory relationship between HNF4A and DNAJC22 across diverse species provides a solid foundation for these comparative approaches .

How does HNF4A regulate DNAJC22 expression and what experimental evidence supports this relationship?

HNF4A has been identified as a major transcriptional regulator of DNAJC22 through a comprehensive approach combining computational and experimental methodologies. The regulatory relationship is supported by the following evidence:

  • Co-expression analysis: Self-organizing map (SOM) clustering revealed strong co-expression between HNF4A and DNAJC22 across tissues and cell types in both mouse and human datasets. Pearson's correlation coefficient analysis confirmed one of the highest correlations between HNF4A and DNAJC22 compared to other transcription factors .

  • Binding site prediction: Multiple algorithms (TFBIND, PROMO, MATCH) identified five potential HNF4A binding sites within the murine DNAJC22 locus. The most highly conserved binding site was found to be functionally relevant .

  • ChIP-seq and ChIP-qPCR validation: Chromatin immunoprecipitation experiments confirmed direct binding of HNF4A to the DNAJC22 locus in tissues with high co-expression, such as kidney .

  • Functional reporter assays: Luciferase assays using constructs containing the predicted binding sites confirmed functional binding of HNF4A, with mutation of the conserved binding site abolishing this effect .

  • Cross-species conservation: The regulatory relationship between HNF4A and DNAJC22 was confirmed in multiple species including mouse, human, fruitfly, and zebrafish, demonstrating evolutionary conservation of this transcriptional mechanism .

This multi-faceted evidence firmly establishes HNF4A as a critical regulator of DNAJC22 expression across diverse species and tissues.

What computational approaches can be used to identify additional transcriptional regulators of DNAJC22?

To identify potential transcriptional regulators of DNAJC22 beyond HNF4A, the following integrated computational workflow is recommended:

  • Co-expression analysis:

    • Self-organizing map (SOM) clustering to identify genes co-expressed with DNAJC22 across tissues

    • Weighted correlation network analysis (WGCNA) as an alternative approach for identifying co-expression modules

    • Hierarchical clustering to identify subclusters of co-expressed transcription factors

  • Transcription factor binding prediction:

    • Use complementary algorithms (iRegulon, pcaGoPromoter) for unbiased prediction of transcription factors

    • Apply sequence-specific binding prediction tools (TFBIND, PROMO, MATCH) to identify potential binding sites

    • Cross-reference predictions from multiple algorithms to identify high-confidence candidates

  • Integration of predictions with co-expression data:

    • Overlay transcription factor predictions with co-expression results

    • Prioritize transcription factors that are both predicted to bind and co-expressed with DNAJC22

    • Calculate correlation coefficients between DNAJC22 and predicted factors

  • Mining public transcriptome datasets:

    • Analyze expression of DNAJC22 in datasets where candidate transcription factors are perturbed

    • Focus on knockout, knockdown, or overexpression studies of predicted factors

    • Evaluate changes in DNAJC22 expression following transcription factor perturbation

  • ChIP-seq data mining:

    • Re-analyze publicly available ChIP-seq datasets for predicted transcription factors

    • Look for binding evidence at the DNAJC22 locus

    • Assess conservation of binding sites across species

This approach has successfully identified HNF4A as a major regulator of DNAJC22 and can be applied to discover additional transcriptional mechanisms controlling DNAJC22 expression in different contexts .

How might recombinant DNAJC22 be used to study protein-protein interactions and identify binding partners?

Recombinant Pongo abelii DNAJC22 provides a valuable tool for investigating protein-protein interactions through multiple complementary approaches:

  • Pull-down assays:

    • Immobilize tagged recombinant DNAJC22 on appropriate affinity matrices

    • Incubate with cell or tissue lysates from relevant sources

    • Identify binding partners using mass spectrometry

    • Validate interactions with co-immunoprecipitation using specific antibodies

  • Yeast two-hybrid screening:

    • Use DNAJC22 or specific domains as bait

    • Screen against cDNA libraries from tissues with high DNAJC22 expression

    • Confirm positive interactions with secondary assays

  • Proximity labeling approaches:

    • Generate fusion proteins of DNAJC22 with BioID or APEX2

    • Express in relevant cell types to identify proximal proteins

    • Compare interactome in different cellular compartments or conditions

  • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI):

    • Use purified recombinant DNAJC22 to measure binding kinetics with candidate partners

    • Determine association and dissociation constants for interactions

    • Test how interactions are affected by mutations or conditions

  • Cross-linking mass spectrometry:

    • Perform protein cross-linking followed by mass spectrometry

    • Identify interaction interfaces between DNAJC22 and partners

    • Map binding domains within protein complexes

Given DNAJC22's membership in the DnaJ/Hsp40 family, expected interaction partners may include Hsp70 chaperones and their substrates. Additionally, based on its potential membrane association, interactions with membrane proteins or membrane-associated complexes should be investigated .

What research questions remain unresolved about DNAJC22 structure and function that should be prioritized?

Despite the identification of HNF4A as a transcriptional regulator of DNAJC22, several critical research questions remain unresolved:

  • Subcellular localization:

    • What is the precise subcellular localization of DNAJC22?

    • Does it associate with specific organelles or membrane compartments?

    • How does localization differ across cell types and conditions?

  • Functional role in vertebrates:

    • What are the physiological functions of DNAJC22 in mammalian systems?

    • Does it retain functions related to tubular organ development similar to Drosophila Wurst?

    • What phenotypes result from DNAJC22 knockout in vertebrate models?

  • Interaction partners:

    • What are the direct binding partners of DNAJC22?

    • Does it interact with specific Hsp70 family members?

    • What substrates does it help fold or degrade?

  • Domain-specific functions:

    • What is the functional significance of the J-domain in DNAJC22?

    • Are there additional functional domains beyond those currently characterized?

    • How do post-translational modifications affect DNAJC22 function?

  • Tissue-specific regulation:

    • Beyond HNF4A, what other factors regulate DNAJC22 expression in different tissues?

    • How is DNAJC22 expression modulated under stress conditions?

    • Are there tissue-specific splice variants with distinct functions?

  • Disease associations:

    • Is DNAJC22 dysregulation associated with specific pathologies?

    • Could DNAJC22 be a therapeutic target for certain conditions?

    • Are there DNAJC22 variants associated with human disease?

Addressing these questions will require multidisciplinary approaches combining structural biology, functional genomics, and model organism studies to fully elucidate the biological significance of this evolutionarily conserved protein .

What are the optimal conditions for working with recombinant Pongo abelii DNAJC22 in biochemical assays?

When designing experiments with recombinant Pongo abelii DNAJC22, the following technical considerations should be implemented:

  • Storage and stability:

    • Store stock preparations at -20°C for regular use or -80°C for long-term storage

    • Prepare small working aliquots to avoid repeated freeze-thaw cycles

    • Working aliquots can be maintained at 4°C for up to one week

    • The protein is typically supplied in Tris-based buffer with 50% glycerol for stability

  • Buffer conditions:

    • For functional assays, consider buffers that maintain J-domain functionality

    • Standard starting conditions include 25 mM Tris-HCl (pH 7.4), 50 mM KCl, 5 mM MgCl₂

    • Include ATP (1-5 mM) when testing interactions with potential Hsp70 partners

    • Consider adding reducing agents (1-5 mM DTT or 0.1-1 mM TCEP) to maintain protein stability

  • Protein concentration:

    • Optimal working concentrations typically range from 0.1-5 μM for most biochemical assays

    • Higher concentrations may be required for structural studies

    • Monitor for aggregation at higher concentrations

  • Assay temperature:

    • Standard assays can be performed at 25-30°C

    • For heat shock response studies, test functionality at elevated temperatures (37-42°C)

    • For co-chaperone activity assays, include temperature gradients to establish optimal conditions

  • Co-factors and additives:

    • Include ATP when studying potential co-chaperone activities

    • Consider testing zinc supplementation if investigating potential zinc-binding properties

    • For membrane interaction studies, incorporate appropriate lipid compositions

These technical parameters provide a starting framework for experimental design, but optimization may be required for specific assay conditions .

How should researchers approach the validation of DNAJC22 antibodies for immunological techniques?

Rigorous validation of antibodies against DNAJC22 is crucial for reliable results in immunological applications. A comprehensive validation approach should include:

  • Initial characterization:

    • Test antibodies against recombinant Pongo abelii DNAJC22 protein to confirm reactivity

    • Evaluate specificity using Western blot with positive controls

    • Determine optimal working dilutions for different applications

  • Specificity validation:

    • Perform siRNA/shRNA knockdown of DNAJC22 and verify signal reduction

    • If available, use DNAJC22 knockout/null samples as negative controls

    • Test cross-reactivity with related DnaJ family members

    • Perform peptide competition assays to confirm epitope specificity

  • Cross-species reactivity assessment:

    • Test reactivity against DNAJC22 from multiple species to determine conservation of epitopes

    • Align sequences to predict cross-reactivity based on epitope conservation

  • Application-specific validation:

    • For immunohistochemistry/immunofluorescence: include positive and negative tissue controls

    • For immunoprecipitation: verify enrichment of DNAJC22 from complex samples

    • For ChIP applications: validate antibody specificity and efficiency in chromatin contexts

  • Publication transparency:

    • Document all validation steps following antibody reporting standards

    • Report catalog numbers, lot numbers, and specific validation results

    • Share validation data with the research community

What statistical approaches are most appropriate for analyzing DNAJC22 expression data across multiple tissues and conditions?

When analyzing DNAJC22 expression data across diverse tissues and experimental conditions, the following statistical approaches are recommended:

  • Normalization strategies:

    • For RNA-seq data: Use TPM (Transcripts Per Million) or FPKM (Fragments Per Kilobase Million) for within-sample comparisons

    • For microarray data: Apply robust multi-array average (RMA) or quantile normalization

    • Consider batch effect correction using ComBat or similar methods when combining datasets

  • Differential expression analysis:

    • For RNA-seq count data: Use DESeq2 or edgeR with appropriate dispersion estimation

    • For microarray data: Apply limma with empirical Bayes moderation

    • Include relevant covariates in models to account for potential confounding factors

  • Co-expression analysis:

    • Self-organizing maps (SOM) have proven effective for identifying genes co-expressed with DNAJC22

    • Weighted correlation network analysis (WGCNA) provides an alternative approach for identifying co-expression modules

    • Pearson or Spearman correlation coefficients can quantify relationships between DNAJC22 and potential regulators like HNF4A

  • Multi-omics integration:

    • Canonical correlation analysis (CCA) for integrating expression with other data types

    • Multi-factor analysis for harmonizing diverse data sources

    • Network-based approaches for visualizing regulatory relationships

  • Visualization techniques:

    • Heatmaps with hierarchical clustering to visualize expression patterns across tissues

    • Principal component analysis (PCA) or t-SNE for dimensionality reduction and sample clustering

    • Correlation matrices to display relationships between DNAJC22 and other genes of interest

These analytical approaches have successfully revealed the co-expression relationship between DNAJC22 and HNF4A and can be applied to discover additional regulatory mechanisms and functional associations .

How can researchers integrate transcriptome data with ChIP-seq results to build comprehensive models of DNAJC22 regulation?

Integrating transcriptome data with ChIP-seq results provides a powerful approach to comprehensively model DNAJC22 regulation. The following methodology is recommended based on successful identification of HNF4A as a DNAJC22 regulator:

  • Data collection and preprocessing:

    • Gather tissue-specific transcriptome data (RNA-seq or microarray) across diverse conditions

    • Collect ChIP-seq datasets for candidate transcription factors from matching tissues when possible

    • Apply appropriate quality control and normalization to both data types

  • Co-expression analysis:

    • Identify genes co-expressed with DNAJC22 using SOM clustering or WGCNA

    • Focus on transcription factors within co-expression clusters

    • Calculate correlation coefficients to quantify expression relationships

  • ChIP-seq peak identification and annotation:

    • Call peaks from ChIP-seq data using MACS2 or similar algorithms

    • Annotate peaks relative to gene features (promoters, enhancers, etc.)

    • Identify transcription factor binding sites within the DNAJC22 locus

  • Motif analysis and binding site prediction:

    • Perform de novo motif discovery on ChIP-seq peaks

    • Scan the DNAJC22 locus for predicted binding motifs

    • Cross-reference with published position weight matrices

  • Integrative analysis:

    • Overlap co-expressed transcription factors with those binding near DNAJC22

    • Examine correlation between binding strength and expression level

    • Construct gene regulatory networks incorporating both data types

  • Validation with perturbation data:

    • Analyze DNAJC22 expression in datasets where predicted regulators are perturbed

    • Compare predictions with actual expression changes following knockdown/overexpression

    • Refine models based on functional validation results

This integrated approach successfully identified HNF4A as a major regulator of DNAJC22 and can be extended to discover additional regulatory mechanisms controlling DNAJC22 expression in different cellular contexts .

What are the emerging technologies that could advance our understanding of DNAJC22 function?

Several cutting-edge technologies hold significant promise for elucidating the function of DNAJC22:

  • CRISPR-based approaches:

    • CRISPR/Cas9 knockout or knockin models in relevant cell types

    • CRISPRi/CRISPRa for reversible modulation of DNAJC22 expression

    • Base editing or prime editing for introducing specific mutations

    • CRISPR screens to identify genetic interactions with DNAJC22

  • Advanced imaging techniques:

    • Super-resolution microscopy to precisely localize DNAJC22 within cells

    • Live-cell imaging with fluorescently tagged DNAJC22 to track dynamics

    • Correlative light and electron microscopy for ultrastructural context

    • FRET/FLIM to investigate protein-protein interactions in situ

  • Single-cell technologies:

    • Single-cell RNA-seq to reveal cell type-specific expression patterns

    • Single-cell ATAC-seq to map chromatin accessibility at the DNAJC22 locus

    • Spatial transcriptomics to map DNAJC22 expression within tissue architecture

    • Single-cell proteomics to analyze protein-level regulation

  • Structural biology advances:

    • Cryo-EM to determine DNAJC22 structure and complexes

    • Hydrogen-deuterium exchange mass spectrometry for conformational dynamics

    • AlphaFold2 or RoseTTAFold predictions validated with experimental data

    • Integrative structural biology combining multiple techniques

  • Functional genomics:

    • Massively parallel reporter assays to comprehensively map regulatory elements

    • Organoid models to study DNAJC22 function in physiologically relevant systems

    • Multi-omics profiling to capture regulation at multiple molecular levels

These technologies can provide unprecedented insights into DNAJC22 function beyond what has been possible with traditional approaches used to identify its regulation by HNF4A .

How might understanding DNAJC22 function contribute to broader knowledge of heat shock protein biology?

Elucidating DNAJC22 function has significant potential to expand our understanding of heat shock protein biology in several key areas:

  • Specialized co-chaperone functions:

    • DNAJC22 may represent a specialized subfamily C member with unique client specificity

    • Understanding its function could reveal novel aspects of J-domain protein diversity

    • Its conservation suggests fundamental roles distinct from better-characterized DnaJ proteins

  • Tissue-specific roles of heat shock proteins:

    • The HNF4A-mediated regulation suggests tissue-specific functions in organs where this transcription factor is active

    • This could reveal how heat shock protein networks are adapted to tissue-specific requirements

    • May provide insights into organ-specific stress responses and quality control mechanisms

  • Evolutionary adaptations of the heat shock response:

    • The conservation of DNAJC22 from insects to primates provides an opportunity to study evolution of heat shock protein functions

    • Comparative studies can reveal ancestral versus derived functions

    • May identify fundamental versus specialized roles across phylogeny

  • Membrane-associated chaperone activities:

    • If DNAJC22 is membrane-associated as suggested by sequence analysis, it may illuminate specialized roles in membrane protein quality control

    • Could provide insights into compartment-specific chaperone functions

    • May reveal novel mechanisms for integrating stress responses across cellular compartments

  • Integration with regulatory networks:

    • The regulatory relationship with HNF4A connects heat shock protein function with broader transcriptional networks

    • This could reveal how chaperone systems are integrated with developmental and physiological regulation

    • May provide insights into tissue-specific modulation of proteostasis

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.