Recombinant Pongo abelii Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (RPN2)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
RPN2; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase 63 kDa subunit; Ribophorin II; RPN-II; Ribophorin-2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
23-631
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
LTPTHYLTKHDVERLKASLDRPFTNLESAFYSIVGLSSLGAQVPDAKKACTYIRSNLDPS NVDSLFYAAQASQALSGCEISISNETKDLLLAAVSEDSSVTQIYHAVAALSGFGLPLASQ EALSALTARLSKEETVLATVQALQTASHLSQQADLRSIVEEIEDLVARLDELGGVYLQFE EGLETTALFVAATYKLMDHVGTEPSIKEDQVIQLMNAIFSKKNFESLSEAFSVASVAAVL SHNRYHVPVVVVPEGSASDTHEQAILRLQVTNVLSQPLTQATVKLEHAKSVASRATVLQK TSFTPVGDVFELNFMNVKFSSGYYDFLVKVEGDNRYIANTVELRVKISTEVGITNVDLST VDKDQSIAPKTTRVTYPAKAKGTFIADSHQNFALFFQLVDVNTGAELTPHQTFVRLHNQK TGQEVVFVAEPDSKNVYKFELDTSERKIEFDSASGTYTLYLIIGDATLKNPILWNVADVV IKFPEEEAPSTVLSQNLFTPKQEIQHLFREPEKRPPTVVSNTFTALILSPLLLLFALWIR IGANVSNFTFTPSTIIFHLGHAAMLGLMYVYWTQLNMFQTLKYLAILGSVTFLAGNRMLA QQAVKRTAH
Uniprot No.

Target Background

Function
This protein is a subunit of the oligosaccharyltransferase (OST) complex. The OST complex catalyzes the transfer of a defined glycan (Glc3Man9GlcNAc2 in eukaryotes) from the lipid carrier dolichyl-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This is the initial step in N-glycosylation. N-glycosylation is a cotranslational process, and the OST complex associates with the Sec61 complex at the translocon, which mediates protein translocation across the endoplasmic reticulum (ER). All subunits are necessary for optimal enzyme activity.
Database Links
Protein Families
SWP1 family
Subcellular Location
Endoplasmic reticulum. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is RPN2 and what are its primary functions in cellular processes?

RPN2 (Ribophorin II) is a highly conserved glycoprotein located exclusively in the membranes of the rough endoplasmic reticulum (ER) that plays essential roles in protein translocation and maintaining the structural uniqueness of the rough ER . It functions as an integral component of the oligosaccharyltransferase (OST) complex, which conjugates high mannose oligosaccharides to asparagine residues in the N-X-S/T consensus motif of nascent polypeptide chains .

Methodologically, researchers studying RPN2's basic functions typically employ:

  • Immunofluorescence microscopy to visualize subcellular localization

  • Co-immunoprecipitation assays to identify interaction partners within the OST complex

  • Pulse-chase experiments to monitor glycoprotein synthesis and maturation

  • Site-directed mutagenesis to investigate functional domains

How does RPN2 expression differ between normal and malignant tissues?

RPN2 shows significant expression differences between normal tissues and various cancer types. In colorectal cancer (CRC), higher RPN2 expression positively correlates with tumor size . Similarly, in non-small-cell lung cancer (NSCLC), elevated RPN2 expression is associated with early and distant recurrence as well as poor survival outcomes .

To methodically investigate these differences, researchers should:

  • Perform quantitative RT-PCR on matched normal/tumor samples

  • Conduct tissue microarray analysis with immunohistochemistry

  • Analyze gene expression databases like TCGA and GTEx

  • Use Western blotting to compare protein levels across multiple samples

  • Correlate expression with clinicopathological parameters

What experimental models are most appropriate for RPN2 functional studies?

For investigating RPN2 functions, researchers have successfully employed:

In vitro models:

  • Established cancer cell lines with different RPN2 expression levels (HCT116, HT-29, LoVo, SW480 for CRC studies)

  • Stable RPN2 knockdown clones using shRNA (e.g., HCT116-shRPN2, HT-29-shRPN2)

  • Transient knockdown using siRNA transfection systems

  • Rescue experiments with lentiviral vector plasmids (e.g., pCDH-RPN2)

In vivo models:

  • Xenograft models in mice using established cell lines with modulated RPN2 expression

  • Patient-derived xenografts to maintain tumor heterogeneity

  • Orthotopic implantation models to study metastasis

Each model offers distinct advantages depending on the research question, with careful consideration needed for translating findings between systems.

How does RPN2 regulate cancer cell proliferation through N-glycosylation mechanisms?

RPN2 controls cancer cell proliferation primarily through regulating the N-glycosylation of critical cell surface receptors. In colorectal cancer, RPN2 silencing reduces glycosylation of EGFR (Epidermal Growth Factor Receptor), a highly N-linked glycosylated cell surface glycoprotein with 11 consensus N-linked glycosylation sites in its extracellular domain . This deglycosylation leads to:

  • Reduced total EGFR expression (approximately 25% decrease)

  • Decreased molecular weight of EGFR due to impaired glycosylation

  • Diminished phosphorylation of EGFR (p-EGFR: Y1068)

  • Downregulation of downstream ERK1/2 phosphorylation

  • Increased expression of Cyclin C protein, which accumulates in G1 phase

The methodological workflow to study this mechanism involves:

  • Western blotting with and without PNGase F treatment to confirm glycosylation status

  • Flow cytometry for cell cycle analysis, showing G1 phase accumulation in RPN2-depleted cells

  • Colony formation assays to directly observe growth inhibition

  • Rescue experiments to verify specificity of observed effects

What are the molecular mechanisms of RPN2-mediated drug resistance in cancer?

RPN2 contributes to drug resistance through several interconnected mechanisms:

  • Glycosylation of drug transporters: RPN2 regulates the glycosylation of P-glycoprotein, affecting its membrane localization and function in drug efflux .

  • Modulation of apoptotic pathways: RPN2 silencing in lung cancer cells induces intrinsic apoptosis by:

    • Increasing pro-apoptotic Bax expression

    • Decreasing anti-apoptotic Bcl-2 expression

  • Altered receptor signaling: Deglycosylation of receptors like EGFR disrupts survival signaling pathways .

To investigate these mechanisms, researchers should:

  • Perform drug sensitivity assays (IC50 determinations) before and after RPN2 modulation

  • Analyze apoptosis via Hoechst staining and quantification of apoptotic cells

  • Conduct Western blot analysis of key pathway proteins (Bax, Bcl-2, etc.)

  • Use combination studies with pathway inhibitors to confirm mechanism specificity

How does RPN2 expression correlate with clinical outcomes in different cancer types?

RPN2 expression strongly correlates with poor clinical outcomes across multiple cancer types:

In NSCLC:

In CRC:

  • Positive correlation between RPN2 overexpression and tumor size

  • Potential association with malignant progression

Methodological approaches for clinical correlation studies should include:

  • Quantitative measurement of RPN2 expression in patient cohorts via qRT-PCR

  • Kaplan-Meier survival analysis stratified by RPN2 expression levels

  • Multivariate Cox regression analysis to assess independent prognostic value

  • Meta-analysis across multiple cohorts to increase statistical power

What are the most effective approaches for modulating RPN2 expression in experimental systems?

Several effective approaches for modulating RPN2 expression have been validated:

For downregulation:

  • shRNA stable knockdown:

    • Establish stable clones expressing shRNA against RPN2 (e.g., HCT116-shRPN2)

    • Benefits: Long-term suppression, consistent phenotype

    • Limitations: Clone selection bias, potential adaptation

  • siRNA transient knockdown:

    • Transfection of siRNA targeting RPN2 (typically 90% knockdown efficiency)

    • Benefits: Rapid effect, minimal adaptation

    • Limitations: Transient effect, transfection efficiency variability

For overexpression:

  • Lentiviral vector systems:

    • Transfection with lentiviral vector plasmids (e.g., pCDH-RPN2)

    • Benefits: High efficiency, stable integration

    • Considerations: Requires viral packaging, biosafety precautions

For validation:

  • Always confirm RPN2 modulation via Western blot and qRT-PCR

  • Include appropriate controls (shNC, scrambled siRNA, empty vector)

  • Perform rescue experiments to verify specificity of observed phenotypes

How can researchers effectively analyze N-glycosylation changes in RPN2-modulated systems?

To analyze N-glycosylation changes after RPN2 modulation, researchers should employ:

  • Western blotting with glycosidase treatment:

    • Compare protein molecular weights before and after PNGase F treatment

    • Quantify mobility shifts as indicators of glycosylation status

    • Include controls to verify complete deglycosylation

  • Lectin blotting:

    • Use specific lectins (e.g., ConA, WGA) to detect different glycan structures

    • Compare binding patterns between control and RPN2-modulated samples

  • Mass spectrometry-based glycoproteomics:

    • Enrich glycopeptides using lectin affinity chromatography

    • Identify site-specific glycosylation changes

    • Perform quantitative comparison between conditions

  • Cell surface biotinylation assays:

    • Assess membrane localization of glycoproteins

    • Determine if RPN2 modulation affects trafficking of key receptors

  • Fluorescent labeling of glycans:

    • Use click chemistry approaches for metabolic labeling

    • Visualize glycan distribution by microscopy or flow cytometry

What controls and validation steps are essential when studying contradictory effects of RPN2 in different cancer models?

When investigating potentially contradictory effects of RPN2 across different models, researchers should implement:

  • Multiple model validation:

    • Test effects in at least 2-3 cell lines of the same cancer type

    • Compare results across different cancer types

    • Validate key findings in patient-derived samples

  • Comprehensive phenotype assessment:

    • Examine multiple functional endpoints (proliferation, apoptosis, invasion)

    • Quantify effects using complementary methodologies

    • Analyze dose-dependent and time-dependent responses

  • Pathway verification:

    • Confirm mechanism by modulating upstream and downstream pathway components

    • Use specific inhibitors to validate observed signaling changes

    • Perform rescue experiments with key pathway components

  • Control for off-target effects:

    • Use multiple siRNA/shRNA sequences targeting different regions of RPN2

    • Include non-targeting controls

    • Test for potential miRNA-like off-target effects

  • Standardized reporting:

    • Document experimental conditions thoroughly

    • Report positive and negative results

    • Address inconsistencies transparently in publications

What approaches can be used to target RPN2 therapeutically in cancer treatment?

Several promising approaches for therapeutic targeting of RPN2 include:

  • RNAi-based strategies:

    • siRNA delivery systems have shown efficacy in preclinical models

    • Lipid nanoparticles, aptamer-siRNA chimeras, or peptide-based delivery vehicles

    • Advantages: Highly specific, potent knockdown

    • Challenges: Delivery to tumor tissue, stability in circulation

  • Combination with standard chemotherapeutics:

    • RPN2 silencing sensitizes cancer cells to:

      • Cisplatin in NSCLC models

      • Docetaxel in breast cancer models

    • Strategy: Administer RPN2 inhibitor as chemosensitizer before standard therapy

  • Glycosylation inhibitors:

    • Target the function of the OST complex rather than RPN2 directly

    • Monitor for potential off-target effects due to broad impact on glycosylation

  • Immune-based approaches:

    • Develop antibodies targeting tumor-specific glycoforms dependent on RPN2

    • Design CAR-T cells recognizing aberrant glycosylation patterns

To validate therapeutic potential, researchers should:

  • Establish dose-response relationships in multiple models

  • Assess on-target and off-target effects

  • Evaluate potential resistance mechanisms

  • Determine pharmacokinetic and pharmacodynamic parameters

How can RPN2 expression be effectively used as a prognostic biomarker in cancer patients?

To develop RPN2 as an effective prognostic biomarker, researchers should:

  • Standardize detection methods:

    • Establish validated qRT-PCR protocols for tissue samples

    • Develop and validate immunohistochemistry scoring systems

    • Create reference standards for quantification

  • Define clinical cutoff values:

    • Analyze large patient cohorts to establish expression thresholds

    • Use ROC curve analysis to optimize sensitivity and specificity

    • Validate cutoffs in independent cohorts

  • Integrate with existing biomarkers:

    • Assess RPN2 in combination with established markers

    • Develop multiparameter prognostic models

    • Compare with standard clinical risk stratification tools

  • Perform prospective validation:

    • Design prospective clinical studies to validate prognostic value

    • Include diverse patient populations and treatment regimens

    • Assess ability to guide treatment decisions

How should researchers analyze contradictory data regarding RPN2 function across different experimental systems?

When encountering contradictory data about RPN2 function, researchers should:

  • Perform systematic comparative analysis:

    • Create a structured comparison table of experimental conditions

    • Identify critical differences in:

      • Cell types/tissue origin

      • RPN2 expression levels (baseline and after modulation)

      • Experimental timepoints

      • Functional assays used

    • Meta-analyze findings across multiple studies

  • Consider context-specific factors:

    • Evaluate genetic background of models (p53, k-ras status, etc.)

    • Assess glycosylation status of key target proteins

    • Examine compensatory mechanisms that may develop

  • Statistically robust approaches:

    • Use appropriate statistical tests for specific data types

    • Report effect sizes along with p-values

    • Consider Bayesian approaches for weighing contradictory evidence

    • Implement sensitivity analyses to test robustness of findings

  • Address publication bias:

    • Conduct thorough literature searches including preprints

    • Contact authors of published studies for unreported negative results

    • Consider registered reports for controversial findings

What statistical methods are most appropriate for analyzing the relationship between RPN2 expression and cancer outcomes?

To robustly analyze RPN2 expression in relation to cancer outcomes, researchers should employ:

  • For survival analysis:

    • Kaplan-Meier curves with log-rank tests for univariate analysis

    • Cox proportional hazards regression for multivariate analysis

    • Competing risk models when appropriate

    • Time-dependent ROC curve analysis to assess predictive accuracy

  • For expression-phenotype correlations:

    • Spearman or Pearson correlation depending on data distribution

    • Multiple regression models adjusting for confounding factors

    • Propensity score matching to control for selection bias

  • For high-dimensional data integration:

    • Supervised machine learning approaches (random forests, SVM)

    • Network analysis to identify RPN2-associated pathways

    • Regularized regression methods (LASSO, elastic net) for feature selection

  • For meta-analysis across studies:

    • Random-effects models to account for between-study heterogeneity

    • Forest plots to visualize effect estimates

    • Funnel plots to assess publication bias

When reporting results, provide clear information on:

  • Sample sizes and power calculations

  • Effect sizes with confidence intervals

  • Multiple testing corrections applied

  • Model assumptions and validation procedures

How can researchers distinguish between direct effects of RPN2 on glycosylation and secondary cellular responses?

Distinguishing direct RPN2 glycosylation effects from secondary responses requires:

  • Temporal analysis:

    • Implement time-course experiments after RPN2 modulation

    • Monitor glycosylation changes before downstream phenotypic alterations

    • Use rapid inducible systems (e.g., Tet-ON/OFF) for precise temporal control

  • Substrate-specific approaches:

    • Identify direct glycosylation targets using glycoproteomics

    • Create mutant constructs lacking N-glycosylation sites (N→Q mutations)

    • Compare effects of RPN2 knockdown versus site-specific glycosylation inhibition

  • Pathway dissection:

    • Use specific inhibitors at different levels of signaling cascades

    • Implement genetic rescue experiments with constitutively active downstream effectors

    • Analyze protein-protein interactions with and without glycosylation

  • Systems biology integration:

    • Combine transcriptomics, proteomics, and glycomics data

    • Construct pathway models to predict direct versus indirect effects

    • Validate predictions using targeted interventions

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.