Recombinant Pongo abelii Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1)

Shipped with Ice Packs
In Stock

Description

Protein Nomenclature and Identification

The recombinant protein can be identified through various official designations and database entries as detailed in the following table:

Identification ParameterDetails
Recommended NameDolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1
Short NameOligosaccharyl transferase subunit DAD1
Alternative NamesDefender against cell death 1 (DAD)
UniProt IDQ5RBB4
Enzyme ClassificationEC 2.4.1.119
Gene NameDAD1
Expression Region2-113

Biological Function and Significance

The DAD1 protein serves critical biological functions that make it an important subject for research in cellular biology and biochemistry.

Enzymatic Activity and Pathway Involvement

The recombinant Pongo abelii DAD1 protein functions as an essential subunit of the N-oligosaccharyl transferase (OST) complex, which catalyzes the transfer of high-mannose oligosaccharides from lipid-linked oligosaccharide donors to asparagine residues within nascent polypeptide chains . This N-glycosylation process occurs cotranslationally as the complex associates with the Sec61 complex at the channel-forming translocon complex that facilitates protein translocation across the endoplasmic reticulum (ER) .

The protein is involved in several critical biological pathways:

  • N-Glycan biosynthesis and protein glycosylation

  • Protein processing in the endoplasmic reticulum

  • Cell survival mechanisms and apoptosis regulation

Role in Cell Survival

One of the most significant aspects of DAD1 is its function as a negative regulator of programmed cell death. The human homolog was initially identified in temperature-sensitive cell lines where its disappearance triggered apoptosis, suggesting that DAD1 plays a crucial role in defending against apoptotic cell death . This protective function underlies the protein's alternative name: Defender against cell death 1 .

The essential nature of DAD1 in eukaryotic cells reflects the critical importance of N-linked glycosylation for cellular viability and function . Research indicates that DAD1 has been shown to interact with MCL1, further supporting its role in apoptosis regulation .

Expression Systems and Production Methods

The recombinant Pongo abelii DAD1 protein is typically produced using various expression systems, with Escherichia coli being the most common host organism . Alternative expression systems may include yeast, baculovirus, or mammalian cell systems, as well as cell-free expression systems . Each production method offers different advantages regarding protein folding, post-translational modifications, and yield.

The production process generally involves:

  1. Cloning the DAD1 gene sequence into an appropriate expression vector

  2. Transforming the host organism with the expression construct

  3. Inducing protein expression under controlled conditions

  4. Purifying the recombinant protein, often using affinity chromatography techniques

  5. Quality control assessment, typically using SDS-PAGE to verify purity

Handling Procedures

To maintain optimal protein integrity during experimental use:

  • Briefly centrifuge vials before opening to bring contents to the bottom

  • Avoid repeated freeze-thaw cycles as this may compromise protein stability

  • Store working aliquots at 4°C for up to one week

  • When reconstituting lyophilized protein, use deionized sterile water

  • Adding glycerol to a final concentration of 5-50% is recommended for long-term storage

  • After reconstitution, aliquot the protein solution to minimize freeze-thaw cycles

Applications in Research

Recombinant Pongo abelii DAD1 protein has various applications in biological and biomedical research, particularly in studies focusing on protein glycosylation, cell death mechanisms, and comparative biology.

Glycosylation Studies

As a component of the N-oligosaccharyl transferase complex, recombinant DAD1 is valuable for investigating:

  • The mechanisms of N-linked glycosylation

  • Structural and functional aspects of the OST complex

  • The role of glycosylation in protein folding and quality control

  • Species-specific differences in glycosylation pathways

Cell Death and Survival Research

Given its established role as a defender against apoptotic cell death, the recombinant protein serves as an important tool for:

  • Studying apoptosis regulation mechanisms

  • Investigating cellular responses to stress conditions

  • Exploring potential therapeutic approaches for diseases involving dysregulated cell death

  • Understanding the link between glycosylation defects and programmed cell death

ELISA and Immunological Applications

Commercially available recombinant Pongo abelii DAD1 is frequently used in ELISA (Enzyme-Linked Immunosorbent Assay) applications for:

  • Detecting anti-DAD1 antibodies

  • Quantifying DAD1 protein levels in biological samples

  • Studying protein-protein interactions involving DAD1

  • Validating antibodies for research applications

Comparative Analysis with Human DAD1

The Pongo abelii DAD1 protein shares significant homology with its human counterpart, making it valuable for comparative studies. The human DAD1 gene is located on chromosome 14q11.2 and encodes a protein with similar structural and functional characteristics .

Both the human and Pongo abelii DAD1 proteins function as subunits of the oligosaccharyltransferase complex and are involved in N-linked glycosylation. The high degree of conservation between these proteins reflects the essential nature of this glycosylation process across mammalian species and provides insights into the evolutionary conservation of critical cellular processes .

The availability of recombinant Pongo abelii DAD1 offers researchers an alternative to human DAD1 for experimental studies, potentially providing complementary information about the function and properties of this important protein.

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have a specific format requirement, please indicate it when placing your order, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the inherent stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
DAD1; Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1; Oligosaccharyl transferase subunit DAD1; Defender against cell death 1; DAD-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
2-113
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
SASVVSVISRFLEEYLSSTPQRLKLLDAYLLYILLTGALQFGYCLLVGTFPFNSFLSGFI SCVGSFILAVRLRIQINPQNKADFQGISPERAFADFLFASTILHLVVMNFVG
Uniprot No.

Target Background

Function
DAD1 is a subunit of the oligosaccharyl transferase (OST) complex. This complex catalyzes the initial transfer of a defined glycan (Glc(3)Man(9)GlcNAc(2) in eukaryotes) from the lipid carrier dolichol-pyrophosphate to an asparagine residue within an Asn-X-Ser/Thr consensus motif in nascent polypeptide chains. This process marks the first step in protein N-glycosylation. N-glycosylation occurs cotranslationally, and the OST complex associates with the Sec61 complex, which is the channel-forming translocon complex that mediates protein translocation across the endoplasmic reticulum (ER). All subunits are essential for maximal enzyme activity.
Database Links
Protein Families
DAD/OST2 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.