Recombinant Pongo abelii Dynamin-like 120 kDa protein, mitochondrial (OPA1)

Shipped with Ice Packs
In Stock

Description

Protein Overview

Recombinant Pongo abelii OPA1 is a dynamin-related GTPase with a molecular weight of approximately 120 kDa. The commercially available form typically consists of 50 μg quantities stored in Tris-based buffer with 50% glycerol for stability . The amino acid sequence exhibits the characteristic domains of the dynamin superfamily, including the GTPase domain critical for its function. The full protein spans amino acids 195-960 of the reference sequence and contains multiple functional domains that facilitate its various mitochondrial activities .

Cristae Architecture Regulation

Beyond its fusion activity, OPA1 serves as a key architect of the inner mitochondrial membrane's cristae structure. The protein forms oligomeric complexes through the interaction of two L-OPA1 molecules with one S-OPA1 molecule, which then stabilize the cristae junctions . This structural regulation is fundamentally important for maintaining efficient oxidative phosphorylation, as proper cristae formation optimizes the assembly and function of respiratory complexes and supercomplexes within the inner membrane.

Bioenergetic Pathway Modulation

Recent metabolomic studies have demonstrated that OPA1 disruption leads to significant remodeling of cellular bioenergetic pathways. Specifically, OPA1 absence affects aspartate metabolism and related metabolites, with notable decreases in aspartate, glutamate, and α-ketoglutaric acid levels, alongside increases in asparagine, glutamine, and adenosine-5'-monophosphate concentrations . These metabolic alterations indicate OPA1's broader role in regulating mitochondrial substrate utilization and energy production beyond its structural functions.

Expression Systems

Recombinant Pongo abelii OPA1 is typically produced using advanced mammalian cell expression systems, which ensure proper post-translational modifications and protein folding. This approach yields protein with characteristics more closely resembling the native form compared to bacterial expression systems. The production process typically involves gene optimization, transfection into mammalian host cells, and subsequent protein purification steps .

Purification and Quality Assessment

Commercial preparations of recombinant Pongo abelii OPA1 undergo rigorous purification protocols to ensure high quality. Standard quality control measures include:

Quality ParameterAssessment MethodTypical Specification
PuritySDS-PAGE and/or HPLC>80% purity
Endotoxin contentLAL method<1.0 EU per μg protein
ActivityGTPase activity assayBatch-specific
IdentityMass spectrometryConfirmation of sequence

The final product is typically supplied in a stabilized form, either as a liquid in PBS buffer or as a lyophilized powder, with recommendations for storage at -20°C to -80°C for long-term stability .

Sequence Homology

The Pongo abelii OPA1 protein shares significant sequence homology with its human counterpart, reflecting the evolutionary conservation of this critical mitochondrial protein. This high degree of conservation makes the Sumatran orangutan variant a valuable model for studying human OPA1-related functions and pathologies. Key differences in specific amino acid residues may provide insights into species-specific adaptations in mitochondrial dynamics.

Functional Conservation

Studies indicate that the fundamental functions of OPA1 are well-conserved between Pongo abelii and humans. Both proteins regulate mitochondrial fusion, maintain cristae structure, and contribute to respiratory chain supercomplex assembly . This functional conservation extends to the protein's role in protecting against apoptosis by preventing cytochrome c release and reducing reactive oxygen species production. The preservation of these critical functions across species underscores the evolutionary importance of OPA1 in mitochondrial homeostasis.

Mitochondrial Dynamics Studies

Recombinant Pongo abelii OPA1 serves as an invaluable tool for investigating the molecular mechanisms of mitochondrial fusion. Researchers utilize this protein in reconstitution experiments, binding assays, and structural studies to elucidate how OPA1 mediates fusion events and interacts with other components of the mitochondrial fusion machinery. These investigations provide critical insights into the fundamental processes governing mitochondrial network maintenance.

Bioenergetic Research

The protein has proven useful in studies exploring the relationship between mitochondrial structure and bioenergetic function. Research has demonstrated that OPA1 plays a critical role in regulating respiratory supercomplexes assembly and organization, with direct implications for oxidative phosphorylation efficiency . The protein's influence extends to mitochondrial swelling responses and permeability transition pore (PTP) function, highlighting its multifaceted role in mitochondrial physiology.

Disease Modeling

Recombinant OPA1 proteins enable the development of in vitro models for studying mitochondrial pathologies. Particularly relevant are investigations into dominant optic atrophy (DOA) and related disorders, where OPA1 mutations lead to mitochondrial dysfunction and subsequent neurodegeneration . By comparing wild-type and mutant forms, researchers can characterize the molecular consequences of pathogenic variations and identify potential therapeutic targets.

Association with Optic Atrophy

Mutations in the OPA1 gene are strongly associated with dominant optic atrophy (DOA), a condition characterized by progressive loss of visual acuity . The OPA1 database currently documents 516 unique OPA1 variants observed in 831 patients, with the majority of these variants (414) classified as pathogenic . Understanding the structure-function relationships of OPA1 through studies with the recombinant protein contributes to elucidating the molecular basis of these conditions.

Extended Neurological Phenotypes

Beyond classical DOA, OPA1 mutations can lead to a spectrum of neurological disorders collectively known as "DOA plus" syndromes. These expanded phenotypes include sensorineural hearing loss, ataxia, sensorimotor neuropathy, progressive external ophthalmoplegia, and mitochondrial myopathy . Research utilizing recombinant OPA1 proteins helps characterize how specific mutations affect protein function and contribute to this diverse clinical spectrum.

Potential Therapeutic Strategies

Recent research has explored therapeutic approaches for OPA1-related disorders, including the development of splice-switching antisense oligonucleotides like STK-002, which reduces poison exon inclusion in the OPA1 transcript, potentially leading to increased functional OPA1 protein levels . Recombinant Pongo abelii OPA1 serves as a valuable tool in screening and validating such therapeutic strategies before clinical testing.

Metabolomic Profiling

Recent metabolomic studies have revealed a distinct bioenergetic signature associated with OPA1 disruption. This signature is characterized by alterations in aspartate metabolism, impaired nucleotide synthesis, and compromised NAD metabolism . These findings suggest broader metabolic consequences of OPA1 dysfunction beyond direct effects on mitochondrial structure and highlight potential metabolic targets for therapeutic intervention in OPA1-related disorders.

Database Development and Variant Analysis

The evolution of the OPA1 database towards the Global Variome shared Leiden Open-source Variation Database (LOVD) format has enhanced the systematic documentation of OPA1 variants and associated phenotypes . This standardized approach facilitates interoperability with other genetic databases and supports large-scale mutation statistics and genotype-phenotype correlations, providing a valuable resource for researchers utilizing recombinant OPA1 proteins in their investigations.

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order notes. We will accommodate your request whenever possible.
Lead Time
Delivery times may vary depending on the purchasing method and location. For precise delivery timelines, please consult your local distributors.
Note: All protein shipments are standardly packaged with blue ice packs. If dry ice shipping is required, please inform us in advance. Additional charges may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we advise adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default glycerol concentration is 50%, which can be used as a reference.
Shelf Life
The shelf life depends on various factors including storage conditions, buffer composition, storage temperature, and protein stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please inform us, and we will prioritize development of that tag.
Synonyms
OPA1; Dynamin-like 120 kDa protein, mitochondrial; Optic atrophy protein 1 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
195-960
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
OPA1
Target Protein Sequence
ATDHGSESDKHFRKVSDKEKIDQLQEELLHTQLKYQRILERLEKENKELRKLVLQKDDKG IHHRKLKKSLIDMYSEVLDVLSDYDASYNTQDHLPRVVVVGDQSAGKTSVLEMIAQARIF PRGSGEMMTRSPVKVTLSEGPHHVALFKDSSREFDLTKEEDLAALRHEIELRMRKNVKEG CTVSPETISLNVKGPGLQRMVLVDLPGVINTVTSGMAPDTKETIFSISKAYMQNPNAIIL CIQDGSVDAERSIVTDLVSQMDPHGRRTIFVLTKVDLAEKNVASPSRIQQIIEGKLFPMK ALGYFAVVTGKGNSSESIEAIREYEEEFFQNSKLLKTSMLKAHQVTTRNLSLAVSDCFWK MVRESVEQQADSFKATRFNLETEWKNNYPRLRELDRNELFEKAKNEILDEVISLSQATPK HWEEILQQSLWERVSTHVIENIYLPAAQTMNSGTFNTTVDIKLKQWTDKQLPNKAVEVAW ETLQGEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRS ISDKQQWDAAIYFMEEALQARLKDTENAIENMVGPDWKKRWLYWKNRTQEQCVHNETKNE LEKMLKCNEEHPAYLASDEITTVRKNLESRGVEVDPSLIKDTWHQVYRRHFLKTALNHCN LCRRGFYYYQRHFVDSELECNDVVLFWRIQRMLAITANTLRQQLTNTEVRRLEKNVKEVL EDFAEDGEKKIKLLTGKRVQLAEDLKKVREIQEKLDAFIEALHQEK
Uniprot No.

Target Background

Function
Dynamin-related GTPase that plays a crucial role in maintaining normal mitochondrial morphology by regulating the balance between mitochondrial fusion and fission. It binds to lipid membranes enriched in negatively charged phospholipids, such as cardiolipin, and facilitates membrane tubulation. While the intrinsic GTPase activity is low, interaction with lipid membranes significantly enhances it. This protein is involved in remodeling cristae and the release of cytochrome c during apoptosis. Proteolytic processing in response to intrinsic apoptotic signals may result in the disassembly of OPA1 oligomers and the release of the caspase activator cytochrome C (CYCS) into the mitochondrial intermembrane space. It plays a role in mitochondrial genome maintenance. The inactive form, produced by cleavage at S1 position by OMA1 following stress conditions that induce loss of mitochondrial membrane potential, negatively regulates mitochondrial fusion. Dynamin-like 120 kDa protein, form S2, is produced by cleavage at position S2 by YME1L and promotes mitochondrial fusion.
Database Links
Protein Families
TRAFAC class dynamin-like GTPase superfamily, Dynamin/Fzo/YdjA family
Subcellular Location
Mitochondrion inner membrane; Single-pass membrane protein. Mitochondrion intermembrane space. Mitochondrion membrane.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.