Recombinant Pongo abelii E3 ubiquitin-protein ligase RNF128 (RNF128)

Shipped with Ice Packs
In Stock

Description

Introduction

Recombinant Pongo abelii E3 ubiquitin-protein ligase RNF128, commonly referred to as RNF128, is an enzyme that functions as an E3 ubiquitin ligase . Ubiquitin ligases are crucial in the process of ubiquitination, where ubiquitin molecules are attached to target proteins, influencing their stability, function, and interactions . RNF128, also known as Grail (a gene related to anergy in lymphocytes), is a type I transmembrane E3 ligase that regulates CD4+ cell tolerance and Treg function .

Structure and Function

RNF128 is an E3 ubiquitin-protein ligase that catalyzes 'Lys-48'- and 'Lys-63'-linked polyubiquitin chains formation . The protein contains a RING finger domain, which is characteristic of E3 ubiquitin ligases . These enzymes facilitate the transfer of ubiquitin from an E2 ubiquitin-conjugating enzyme to a substrate protein . Through its enzymatic activity, RNF128 modifies protein stability and function via direct interactions .

RNF128 functions as an inhibitor of cytokine gene transcription and inhibits IL2 and IL4 transcription, thereby playing an important role in the induction of the anergic phenotype, a long-term stable state of T-lymphocyte unresponsiveness to antigenic stimulation associated with the blockade of interleukin production . RNF128 ubiquitinates ARPC5 with 'Lys-48' linkages and COR1A with 'Lys-63' linkages leading to their degradation, down- regulation of these cytoskeletal proteins .

Expression and Regulation

RNF128 is expressed in various tissues and cell types, including immune cells and cancer cells . Its expression levels can vary depending on the tissue type, developmental stage, and disease state . RNF128 expression was significantly higher in colorectal cancer tissues than in adjacent normal tissues .

Role in Immune Response

Most studies of RNF128 have focused on the differentiation, proliferation and allergic responses of T lymphocytes . RNF128 regulates alveolar macrophage activation and neutrophil infiltration by interacting with TLR4, targeting it for degradation, and inhibiting NF-κB activation, hence decreasing pro-inflammatory cytokines . RNF128 regulates neutrophil MPO expression through direct interactions and can regulate LPS-induced acute lung injury (ALI) . Severe lung damage and increased immune cell infiltration were detected in RNF128-deficient mice .

Implications in Cancer

RNF128 promotes malignant behaviors via the EGFR/MEK/ERK signaling pathway and might function as a novel prognostic molecular signature . RNF128 was highly expressed in CRC and promoted the proliferation, migration and invasion of colorectal cancer cells . RNF128 promotes CRC progression by inhibiting the Hippo signaling pathway, which may provide a new target for colorectal cancer prevention and treatment .

RNF128 and Atherosclerosis

RNF128 promotes atherosclerosis by stabilizing scavenger receptor B1 (SRB1) via polyubiquitination, enhancing foam cell formation and inflammation, while its ablation reduces plaque formation in hyperlipidemic mice .

RNF128 Interacting Proteins

RNF128 interacts with multiple proteins, modulating their function through ubiquitination .

Table 1: Examples of RNF128 Interacting Proteins

ProteinFunctionReference
Myeloperoxidase (MPO)An abundantly expressed protein by human neutrophils for generating chlorinating and other oxidants to kill bacterial and living cells
TLR4Regulates alveolar macrophage activation and neutrophil infiltration
ARPC5Down-regulation of these cytoskeletal proteins
COR1ADown-regulation of these cytoskeletal proteins
Scavenger receptor SRB1Promotes atherosclerosis by stabilizing SRB1 via polyubiquitination

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
RNF128; E3 ubiquitin-protein ligase RNF128; RING finger protein 128; RING-type E3 ubiquitin transferase RNF128
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
39-428
Protein Length
Full Length of Mature Protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
RNF128
Target Protein Sequence
AEAVWTAYLNVSWRVPHTGVNRTVWELSEEGVYGQDSPLEPVAGVLVPPDGPGALNACNP HTNFTVPTVWGSTVQVSWLALIQRGGGCTFADKIHLAYERGASGAVIFNFPGTRNEVIPM SHPGAGDIVAIMIGNLKGTKILQSIQRGIQVTMVIEVGKKHGPWVNHYSIFFVSVSFFII TAATVGYFIFYSARRLRNARAQSRKQRQLKADAKKAIGRLQLRTLKQGDREIGPDGDSCA VCIELYKPNDLVRILTCNHIFHKTCVDPWLLEHRTCPMCKCDILKALGIEVDVEDGSVSL QVPVSNEISNSASSHEEDNRSETASSGYASVQGADEPPLEEHVQSTNENLQLVNHEANSV AVDVIPHVDNPTFEEDETPHQETAVREIKS
Uniprot No.

Target Background

Function

RNF128 is an E3 ubiquitin-protein ligase that catalyzes the formation of both Lys-48- and Lys-63-linked polyubiquitin chains. It functions as a negative regulator of cytokine gene transcription, specifically inhibiting IL-2 and IL-4 transcription. This inhibition plays a critical role in establishing T-lymphocyte anergy, a long-term state of unresponsiveness characterized by suppressed interleukin production. RNF128 ubiquitinates ARPC5 (Lys-48 linkages) and COR1A (Lys-63 linkages), targeting them for degradation. This downregulation of cytoskeletal components impairs lamellipodium formation and reduces F-actin accumulation at the immunological synapse. Furthermore, RNF128 is involved in dorsal ectoderm patterning, sensitizing the ectoderm to neural-inducing signals.

Database Links
Subcellular Location
Endomembrane system; Single-pass membrane protein. Cytoplasm, cytoskeleton. Cytoplasm, perinuclear region.

Q&A

What is the primary function of RNF128 in cellular signaling pathways?

RNF128 functions primarily as an E3 ubiquitin ligase that regulates multiple signaling pathways through targeted protein ubiquitination. Recent research has identified RNF128 as a negative regulator of the IL-3/STAT5 signaling pathway, which is crucial for immune cell development and activation. RNF128 specifically targets the IL-3 receptor α chain (IL-3Rα) for lysosomal degradation through K27-linked polyubiquitination. This mechanism provides selective regulation, as RNF128 does not interact with the common beta chain IL-3Rβ, which is shared with other cytokine receptors such as GM-CSF . The selective binding capacity of RNF128 for specific receptors allows for precise control of downstream signaling pathways, making it an important regulatory molecule in inflammatory and immune responses.

How does RNF128 contribute to immune regulation and inflammatory responses?

RNF128 plays a dual role in immune regulation by modulating both inflammatory signaling and immune cell activation:

  • Negative Regulation of IL-3/STAT5 Signaling: RNF128 targets IL-3Rα for lysosomal degradation, thereby reducing IL-3-triggered STAT5 activation and subsequent transcription of genes such as Id1, Pim1, and Cd69. This mechanism helps prevent excessive immune activation in response to inflammatory stimuli .

  • Attenuation of Macrophage Responses: RNF128 inhibits the activation and chemotaxis of macrophages in response to LPS stimulation, serving as a brake on inflammatory responses. This function suggests a protective role against excessive inflammation .

  • Association with Inflammatory Disease Resolution: Studies have observed increased RNF128 expression upon recovery in ulcerative colitis patients with elevated clinical activity index scores, suggesting its contribution to disease remission. This indicates RNF128 may play a role in alleviating excessive inflammatory responses and preventing organ damage in inflammatory conditions .

The regulatory functions of RNF128 make it a potential molecular target for treating inflammatory and autoimmune diseases characterized by dysregulated immune responses and organ damage.

What are the mechanisms of RNF128-mediated protein ubiquitination and how do they differ by target?

RNF128 exhibits remarkable specificity in its ubiquitination mechanisms depending on the target protein:

  • IL-3Rα Ubiquitination: RNF128 catalyzes K27-linked polyubiquitination of IL-3Rα, targeting it for lysosomal degradation. This mechanism does not affect other related receptors such as the common beta chain (IL-3Rβ) shared with GM-CSF receptor, demonstrating high target specificity .

  • SRB1 Ubiquitination: In contrast to IL-3Rα, RNF128 promotes K63-linked polyubiquitination of SRB1 specifically at lysine 478 in the cytoplasmic C-terminus. This modification does not lead to degradation but instead promotes endosomal recycling of SRB1 to the cell membrane via Rab11-assisted trafficking .

The distinct ubiquitination patterns (K27 vs. K63-linked) result in different fates for the target proteins:

Target ProteinUbiquitin LinkageModification SiteProtein FateFunctional Outcome
IL-3RαK27-linkedNot specifiedLysosomal degradationDecreased IL-3/STAT5 signaling
SRB1K63-linkedLysine 478Endosomal recyclingIncreased membrane localization

These differential mechanisms highlight the versatility of RNF128 as a regulator of protein trafficking and turnover, allowing it to fine-tune multiple cellular processes through distinct ubiquitination strategies .

How does the binding specificity of RNF128 determine its regulatory effects on different signaling pathways?

RNF128's binding specificity is determined by domain-specific interactions that enable it to selectively regulate distinct signaling pathways:

  • IL-3 Signaling Pathway: RNF128 selectively binds to IL-3Rα without interacting with IL-3Rβ. This selective binding leads to negative regulation of IL-3-triggered STAT5 activation without affecting GM-CSF-induced phosphorylation of STAT5, despite both cytokines sharing the common beta chain .

  • Lipid Metabolism Pathway: RNF128 directly binds to SRB1 through its PA domain interacting with the extracellular region of SRB1. Experimental evidence demonstrates that deletion of either the PA domain of RNF128 or the extracellular domain of SRB1 abolishes this interaction. Once bound, RNF128 catalyzes K63-linked polyubiquitination of SRB1 at lysine 478, promoting its endosomal recycling rather than degradation .

The binding specificity of RNF128 is primarily determined by:

  • N-terminal PA Domain: Essential for capturing target proteins like SRB1. Deletion mutant experiments have confirmed that the PA domain is both necessary and sufficient for binding to SRB1 .

  • Signal Peptide: Required for proper localization of RNF128 to cellular compartments where target interactions occur. Deletion of the signal peptide prevents RNF128 from reaching SRB1-rich areas .

These domain-specific interactions allow RNF128 to simultaneously regulate multiple signaling pathways in different cellular contexts, enabling fine-tuned control of diverse biological processes including inflammation and lipid metabolism.

What role does RNF128 play in macrophage function and atherosclerosis development?

RNF128 significantly influences macrophage function in atherosclerosis through several interconnected mechanisms:

  • Expression Pattern in Atherosclerotic Plaques: Single-cell RNA sequencing data reveals that RNF128 is specifically expressed in macrophages within the lipid core of atherosclerotic plaques. Persistent hyperlipidemia induces high expression of RNF128 in macrophages, suggesting a response to the lipid-rich environment .

  • Foam Cell Formation: RNF128 promotes oxidized low-density lipoprotein (oxLDL)-induced foam cell formation in macrophages by stabilizing SRB1, a key receptor involved in lipid uptake. This stabilization occurs through K63-linked polyubiquitination of SRB1 at lysine 478, which prevents lysosomal degradation and promotes recycling to the cell membrane .

  • Impact on Atherosclerosis Progression: Genetic ablation of RNF128 in macrophages ameliorates atherosclerosis in both male and female mice under ApoE and LDLR deficiency backgrounds. This protective effect stems from reduced foam cell formation and inflammatory responses in RNF128-deficient macrophages .

  • Mechanistic Dependency on E3 Ligase Activity: The pro-atherogenic effects of RNF128 depend on its E3 ligase activity. Experiments with catalytically inactive RNF128 mutants (lacking the RING domain) demonstrate loss of function in promoting lipid accumulation and oxLDL uptake in macrophages .

These findings position RNF128 as a potential therapeutic target for atherosclerosis, as its inhibition in macrophages could reduce foam cell formation and subsequent plaque development.

How do different mutations in the RNF128 gene affect its function and what are their physiological consequences?

Various mutations in RNF128 significantly alter its function through different mechanisms:

  • RING Domain Mutations:

    • Deletion Mutants (RNF128 ∆R): Removal of the RING domain abolishes E3 ligase activity. These mutants fail to:
      a) Promote lipid accumulation in macrophages
      b) Enhance oxLDL uptake
      c) Stabilize SRB1 protein levels
      d) Catalyze polyubiquitination of target proteins

    • Point Mutations (C277A and C280A): Substitution of conserved cysteine residues at positions 277 and 280 with alanine disrupts E3 catalytic activity, preventing polyubiquitination of SRB1 .

  • PA Domain Mutations:

    • Deletion Mutants (RNF128-∆PA): Loss of the PA domain prevents interaction with target proteins such as SRB1, thereby eliminating RNF128's regulatory effects on these targets .

  • Signal Peptide Mutations:

    • Deletion Mutants (RNF128-∆SP): Removal of the signal peptide disrupts proper cellular localization, preventing RNF128 from reaching its targets, such as SRB1-rich areas .

The physiological consequences of these mutations include:

Mutation TypeMolecular EffectPhysiological Consequence
RING domain mutationsLoss of E3 ligase activityReduced foam cell formation; Decreased inflammatory response; Protection against atherosclerosis
PA domain mutationsLoss of target bindingFailure to regulate SRB1 stability; Reduced lipid uptake
Signal peptide mutationsImpaired cellular localizationInability to regulate target proteins; Loss of function

These findings highlight the critical importance of RNF128's structural integrity for its proper function in regulating inflammatory responses and lipid metabolism.

What expression systems are optimal for producing recombinant Pongo abelii RNF128 for structural and functional studies?

Producing recombinant Pongo abelii RNF128 requires careful consideration of expression systems to ensure proper folding, post-translational modifications, and functional activity. Based on research approaches used for studying related proteins, the following expression systems are recommended:

  • Mammalian Expression Systems:

    • HEK293T Cells: Optimal for functional studies as they provide the necessary cellular machinery for proper folding and post-translational modifications of mammalian proteins. This system has been successfully used for expressing RNF128 in interaction studies with target proteins such as SRB1 .

    • Methodology: Transfect cells with expression vectors containing the Pongo abelii RNF128 gene with appropriate epitope tags (e.g., Flag or Myc) for detection and purification. For optimal expression, incorporate a strong promoter such as CMV and include a Kozak consensus sequence before the start codon.

  • Insect Cell Expression Systems:

    • Sf9 or High Five Cells: Useful for producing larger quantities of properly folded protein with post-translational modifications. These systems are particularly valuable for structural studies requiring higher protein yields.

    • Methodology: Generate a recombinant baculovirus containing the RNF128 gene, then infect insect cells for protein expression.

  • Bacterial Expression Systems:

    • E. coli (BL21(DE3) strain): Suitable for expressing individual domains of RNF128 (e.g., RING or PA domains) for structural studies or in vitro ubiquitination assays.

    • Methodology: Clone the RNF128 domain of interest into a pET vector with a 6xHis tag for purification. Express at lower temperatures (16-18°C) to enhance proper folding.

When designing expression constructs for Pongo abelii RNF128, consider the following:

  • Include appropriate tags for detection and purification (Flag, Myc, or His)

  • Create domain-specific constructs for structural studies (full-length, ∆RING, PA domain only)

  • Generate catalytically inactive mutants (C277A/C280A) as negative controls

  • Codon-optimize the sequence for the chosen expression system

For functional validation of recombinant Pongo abelii RNF128, perform in vitro ubiquitination assays to confirm E3 ligase activity before proceeding to interaction studies with potential target proteins.

What techniques are most effective for studying RNF128-mediated ubiquitination in cellular systems?

Investigating RNF128-mediated ubiquitination requires a multi-faceted approach combining biochemical, cellular, and genetic techniques:

  • Co-Immunoprecipitation (Co-IP) for Ubiquitination Analysis:

    • Methodology: Transfect cells with tagged versions of RNF128, target protein (e.g., SRB1 or IL-3Rα), and either wild-type or mutant ubiquitin constructs (K48-only or K63-only ubiquitin). After immunoprecipitation of the target protein, perform Western blotting with anti-ubiquitin antibodies to detect specific polyubiquitin chains.

    • Application: This approach has successfully determined that RNF128 catalyzes K63-linked polyubiquitination of SRB1 rather than K48-linked chains .

  • In Vitro Ubiquitination Assays:

    • Methodology: Combine purified components including E1 activating enzyme, E2 conjugating enzyme, recombinant RNF128, the substrate protein, ATP, and either wild-type ubiquitin or specific ubiquitin mutants (K48 or K63). Analyze reaction products by Western blotting.

    • Application: This technique can confirm direct catalytic activity of RNF128 on specific substrates and determine the type of ubiquitin chains formed .

  • Site-Directed Mutagenesis of Target Lysine Residues:

    • Methodology: Generate point mutations of lysine residues in the target protein (e.g., K478R in SRB1) and analyze the effect on ubiquitination patterns.

    • Application: This approach identified lysine 478 as the specific residue on SRB1 that undergoes K63-linked polyubiquitination by RNF128 .

  • Domain Deletion and Truncation Analysis:

    • Methodology: Create deletion mutants of RNF128 (∆RING, ∆SP, ∆PA) and assess their ability to bind targets and catalyze ubiquitination.

    • Application: This technique has revealed the essential roles of specific domains in RNF128 function, such as the requirement of the PA domain for SRB1 binding and the RING domain for ubiquitin ligase activity .

  • Pharmacological Inhibition of Degradation Pathways:

    • Methodology: Treat cells with inhibitors of lysosomal degradation (chloroquine, 3-MA, leupeptin) to distinguish between recycling and degradation pathways.

    • Application: This approach has demonstrated that RNF128-mediated K63-linked ubiquitination promotes endosomal recycling rather than degradation of SRB1 .

These combined approaches provide a comprehensive toolkit for dissecting the molecular mechanisms of RNF128-mediated ubiquitination and its functional consequences in cellular systems.

What are the recommended approaches for investigating RNF128's role in inflammatory and metabolic disease models?

To investigate RNF128's role in inflammatory and metabolic diseases, researchers should employ a combination of genetic, molecular, and translational approaches:

  • Conditional Knockout Models:

    • Methodology: Generate macrophage-specific RNF128 knockout mice (e.g., RNF128 fl/flLyz2-cre) to study cell-specific functions in disease contexts.

    • Application: This approach has demonstrated that macrophage-specific deletion of RNF128 ameliorates atherosclerosis in both ApoE-deficient and LDLR-deficient backgrounds, establishing its pro-atherogenic role .

  • Disease-Specific Models:

    • Inflammatory Disease Models: Apply dextran sodium sulfate (DSS) to induce colitis or lipopolysaccharide (LPS) to trigger systemic inflammation in wild-type versus RNF128-deficient mice.

    • Metabolic Disease Models: Feed high-fat diet to induce atherosclerosis in the context of RNF128 manipulation.

    • Application: These models can reveal how RNF128 modulates disease progression, severity, and resolution. Research has shown that RNF128 expression increases during recovery from ulcerative colitis, suggesting a role in disease remission .

  • Ex Vivo Cell Function Assays:

    • Methodology: Isolate primary macrophages from wild-type and RNF128-deficient mice to assess:
      a) Lipid uptake and foam cell formation using fluorescently labeled oxLDL
      b) Inflammatory cytokine production following LPS stimulation
      c) Migration and chemotaxis assays

    • Application: These assays have revealed that RNF128 promotes oxLDL uptake and enhances inflammatory responses in macrophages .

  • Rescue Experiments:

    • Methodology: Reintroduce wild-type or mutant forms of RNF128 (e.g., RING domain deletions or point mutations) into RNF128-deficient cells to assess functional recovery.

    • Application: This approach has demonstrated that the E3 ligase activity of RNF128 is essential for its effects on lipid accumulation and inflammatory responses .

  • Translational Approaches:

    • Methodology: Analyze RNF128 expression in human disease samples (e.g., atherosclerotic plaques or inflammatory bowel disease biopsies) and correlate with disease severity or stage.

    • Application: Studies have found elevated RNF128 expression in recovering ulcerative colitis patients, suggesting potential as a biomarker for disease remission .

By implementing these diverse approaches, researchers can comprehensively elucidate RNF128's role in inflammatory and metabolic diseases, potentially identifying novel therapeutic targets or biomarkers for disease progression and resolution.

How can interaction partners of RNF128 be identified and validated in experimental systems?

Identifying and validating interaction partners of RNF128 requires a systematic approach combining unbiased screening methods with targeted validation techniques:

  • Yeast Two-Hybrid Screening:

    • Methodology: Use various domains of RNF128 (especially the PA domain) as bait to screen cDNA libraries for potential interacting proteins.

    • Advantage: Can identify novel interaction partners without prior knowledge.

    • Limitation: May identify false positives that interact in yeast but not in mammalian cells.

  • Affinity Purification-Mass Spectrometry (AP-MS):

    • Methodology: Express tagged RNF128 in relevant cell types, perform immunoprecipitation, and identify co-precipitating proteins by mass spectrometry.

    • Application: This approach can identify both stable and transient interactors of RNF128 in a cellular context.

    • Refinement: Compare interactomes of wild-type RNF128 with domain deletion mutants (∆RING, ∆PA) to identify domain-specific interactions.

  • Proximity-Based Labeling:

    • Methodology: Generate fusion proteins of RNF128 with BioID or APEX2, express in cells, and identify proteins in proximity to RNF128 through biotinylation and mass spectrometry.

    • Advantage: Can capture transient or weak interactions that might be lost during conventional immunoprecipitation.

  • Co-Immunoprecipitation Validation:

    • Methodology: Confirm interactions by co-expressing epitope-tagged RNF128 and candidate interactors, followed by immunoprecipitation and Western blotting.

    • Application: This technique has validated the interaction between RNF128 and SRB1, as well as identified the specific domains involved (PA domain of RNF128 and extracellular domain of SRB1) .

  • Domain Mapping:

    • Methodology: Generate truncation mutants of both RNF128 and its interaction partners to map the specific domains required for interaction.

    • Application: This approach revealed that the N-terminus of RNF128, particularly the PA domain, is required for binding to SRB1, while the extracellular domain of SRB1 is necessary for interaction with RNF128 .

  • Fluorescence Microscopy for Colocalization:

    • Methodology: Express fluorescently tagged RNF128 and interaction partners in cells and analyze colocalization by confocal microscopy.

    • Application: This technique has confirmed increased colocalization between SRB1 and Rab11 in the presence of RNF128, supporting a role for RNF128 in promoting endosomal recycling .

  • Functional Validation Through Knockdown/Knockout Studies:

    • Methodology: Assess the impact of RNF128 deficiency on the stability, localization, or function of putative interaction partners.

    • Application: Studies have shown that RNF128 knockout reduces the interaction between SRB1 and Rab11, confirming the functional significance of RNF128 in regulating this interaction .

These complementary approaches provide a comprehensive strategy for identifying and validating interaction partners of RNF128, revealing its diverse roles in cellular signaling networks.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.