Recombinant Pongo abelii Ectonucleoside triphosphate diphosphohydrolase 7 (ENTPD7)

What is Ectonucleoside Triphosphate Diphosphohydrolase 7 (ENTPD7)?

ENTPD7 is a purine-converting ectoenzyme belonging to the ecto-nucleoside triphosphate diphosphohydrolase (E-NTPDase) family. This protein hydrolyzes extracellular nucleoside triphosphates (UTP, GTP, and CTP) to nucleoside monophosphates as part of a purinergic signaling pathway. The protein structure features two transmembrane domains at the N- and C-termini with a large, hydrophobic catalytic domain located between them. ENTPD7 plays significant roles in regulating oxidative stress, DNA damage response, and functions as a mediator of senescence .

What is the structural composition of recombinant Pongo abelii ENTPD7?

Recombinant full-length Pongo abelii ENTPD7 protein consists of 604 amino acids (positions 1-604). When produced for research applications, it is typically fused to an N-terminal His tag and expressed in E. coli expression systems. The full amino acid sequence is available and begins with: MARISFSYLCPASWYFTVPTVSPFLRQRVAFLGLFFISCLLLLMLIIDFRHWSASLPRDR and continues through the full 604 amino acids . The protein contains functional domains necessary for its enzymatic activity, including the catalytic region responsible for nucleotide hydrolysis.

How does ENTPD7 function at the molecular level?

At the molecular level, ENTPD7 functions by hydrolyzing extracellular nucleoside triphosphates to nucleoside monophosphates. This enzymatic activity is part of the purinergic signaling pathway, which regulates various physiological processes. The protein contains transmembrane domains that anchor it to the cell membrane, with its catalytic domain extending into the extracellular space where it can access and process nucleotides. The hydrolysis activity directly affects extracellular ATP levels, which subsequently influences immune responses, particularly Th17 cell development in the small intestine .

What are the optimal storage and reconstitution conditions for recombinant ENTPD7?

For optimal preservation of recombinant Pongo abelii ENTPD7 activity, the protein should be stored at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles, which can compromise protein integrity. Before opening, the vial should be briefly centrifuged to bring contents to the bottom. For reconstitution, the lyophilized protein should be dissolved in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Addition of glycerol (final concentration of 5-50%, with 50% being standard) is recommended for long-term storage at -20°C/-80°C .

How can researchers validate the purity and activity of recombinant ENTPD7?

Researchers can validate the purity of recombinant ENTPD7 through SDS-PAGE analysis, where the protein should demonstrate greater than 90% purity. For activity assessment, enzymatic assays measuring the hydrolysis of nucleoside triphosphates (UTP, GTP, or CTP) to their corresponding monophosphates can be employed. This typically involves incubating the recombinant protein with substrate nucleotides and measuring either the release of inorganic phosphate or the reduction in substrate concentration over time. Western blotting using anti-His tag antibodies can confirm the presence of the tagged protein, while mass spectrometry can provide definitive identification .

What experimental models are suitable for studying ENTPD7 function?

Several experimental models have proven valuable for studying ENTPD7 function:

How does ENTPD7 regulate immune responses, particularly Th17 cell development?

ENTPD7 regulates immune responses by controlling extracellular ATP levels, particularly in the intestinal microenvironment. Targeted deletion of Entpd7 in mice results in increased ATP levels in the small intestinal lumen, which selectively enhances Th17 cell development in the small intestinal lamina propria. This effect appears to be dependent on commensal microbiota, as oral administration of antibiotics decreases Th17 cells in Entpd7-/- mice. Similarly, ATP antagonist administration reduces Th17 cell numbers, confirming that commensal microbiota-dependent ATP release mediates the enhanced Th17 cell development observed in Entpd7-deficient conditions .

The regulatory pathway involves purinergic signaling, where extracellular ATP released from live cells under controlled conditions or dying cells in inflammatory settings interacts with purinergic receptors on immune cells. ENTPD7, preferentially expressed in small intestinal epithelial cells, hydrolyzes this ATP, thereby limiting its availability for Th17 cell induction and proliferation signals .

What role does ENTPD7 play in pathological conditions and disease models?

ENTPD7 demonstrates significant roles in several pathological conditions and disease models:

• Infectious disease resistance: Entpd7-/- mice exhibit resistance to oral infection with Citrobacter rodentium, likely due to enhanced Th17-mediated protective immunity in the intestine .

• Autoimmune pathology: Entpd7-/- mice develop more severe experimental autoimmune encephalomyelitis (EAE), associated with increased numbers of CD4+ T cells producing both IL-17 and IFN-γ. This suggests ENTPD7 may play a protective role in limiting autoimmune responses .

• Oxidative stress and DNA damage: ENTPD7 affects cellular responses to oxidative stress and DNA damage, suggesting potential roles in cellular senescence and related pathologies .

How do chemical compounds modulate ENTPD7 expression and activity?

Various chemical compounds have been shown to modulate ENTPD7 expression through different mechanisms:

How conserved is ENTPD7 across species, and what can we learn from Pongo abelii ENTPD7?

ENTPD7 demonstrates significant evolutionary conservation across mammalian species, indicating its biological importance. The Pongo abelii (Sumatran orangutan) ENTPD7 shares high sequence homology with human ENTPD7, making it a valuable model for understanding human ENTPD7 function. The gene is located on human chromosome 10 and has orthologs in various species tracked through databases like HomoloGene and OMA .

What are the key differences between ENTPD7 and other members of the E-NTPDase family?

The E-NTPDase family includes several ectonucleotidases that participate in extracellular nucleotide-mediated signaling pathways. ENTPD7 differs from other family members in several key aspects:

What are common challenges in expressing and purifying recombinant ENTPD7, and how can they be addressed?

Researchers may encounter several challenges when working with recombinant ENTPD7:

• Protein solubility issues: As a membrane-associated protein with transmembrane domains, ENTPD7 may present solubility challenges. Solution: Express the protein without transmembrane domains or use specialized detergents during purification. The catalytic domain can often be expressed separately with retained activity.

• Maintaining enzymatic activity: The catalytic function may be compromised during expression and purification. Solution: Careful optimization of buffer conditions, including appropriate divalent cations (typically Ca²⁺ or Mg²⁺) which are often required for E-NTPDase activity.

• Protein yield limitations: Expression in E. coli may result in inclusion bodies. Solution: Optimize induction conditions (temperature, IPTG concentration, induction time) or consider eukaryotic expression systems for improved folding.

• Protein stability concerns: Recombinant ENTPD7 may demonstrate limited stability. Solution: Add stabilizing agents in storage buffers, such as the recommended 6% trehalose in Tris/PBS-based buffer (pH 8.0), and maintain strict temperature controls during storage and handling .

How can researchers effectively measure ENTPD7 enzymatic activity in experimental settings?

To effectively measure ENTPD7 enzymatic activity, researchers can employ several methodological approaches:

• Malachite green phosphate assay: Quantifies released inorganic phosphate following nucleotide hydrolysis. This colorimetric method is sensitive and suitable for high-throughput screening.

• HPLC-based substrate depletion: Measures the decrease in substrate concentration (UTP, GTP, CTP) over time through HPLC separation and quantification of nucleotides.

• Coupled enzyme assays: Links ENTPD7 activity to subsequent enzymatic reactions that generate a measurable product, often using spectrophotometric or fluorometric detection.

• Radiometric assays: Utilizes radiolabeled nucleotides as substrates, allowing for sensitive detection of hydrolysis products through scintillation counting.

For optimal results, reaction conditions should be carefully controlled, including:

• Buffer composition (typically Tris-HCl or HEPES, pH 7.4-8.0)

• Divalent cation concentration (1-5 mM Ca²⁺ or Mg²⁺)

• Substrate concentration (typically 50-500 μM nucleotide)

• Reaction temperature (usually 37°C)

• Incubation time (monitored at multiple time points for kinetic analysis)

What emerging applications of ENTPD7 research hold therapeutic potential?

Several emerging research directions for ENTPD7 show therapeutic potential:

• Inflammatory bowel disease interventions: Given ENTPD7's role in regulating intestinal Th17 cell development, targeted modulation could help manage intestinal inflammation in conditions like Crohn's disease or ulcerative colitis .

• Autoimmune disease therapeutics: The involvement of ENTPD7 in experimental autoimmune encephalomyelitis suggests potential applications in treating multiple sclerosis and other T cell-mediated autoimmune conditions .

• Infectious disease immunity: ENTPD7's role in resistance to enteric pathogens like Citrobacter rodentium indicates possible applications in boosting protective immunity against intestinal infections .

• Cancer metabolism regulation: As ENTPD7 affects oxidative stress and DNA damage responses, it may offer targets for cancer therapy, particularly in addressing cellular senescence pathways relevant to tumor suppression .

• Purinergic signaling modulation: Targeting ENTPD7 could allow for specific modulation of extracellular ATP levels in epithelial tissues, with potential applications in inflammatory and immune-mediated disorders .

How might novel analytical techniques advance our understanding of ENTPD7 function?

Emerging analytical techniques hold promise for advancing ENTPD7 research:

• Cryo-electron microscopy: Could provide high-resolution structural insights into ENTPD7's catalytic mechanism and conformational changes during substrate binding and hydrolysis.

• Single-cell transcriptomics: Would enable detailed mapping of ENTPD7 expression patterns across cell types and under various physiological and pathological conditions.

• CRISPR-based functional genomics: Could facilitate comprehensive analysis of ENTPD7's regulatory networks and downstream effectors through targeted genomic modifications.

• Organoid models: Intestinal organoids derived from various species could serve as sophisticated ex vivo systems for studying ENTPD7's tissue-specific functions in a physiologically relevant context.

• Metabolomics approaches: Would allow for detailed characterization of how ENTPD7 activity impacts the broader purinergic metabolite landscape in the cellular microenvironment.

• In vivo imaging techniques: Development of specific probes for ENTPD7 activity could enable real-time visualization of enzymatic function in living tissues and model organisms.