Recombinant Pongo abelii Epithelial membrane protein 1 (EMP1)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Cellular Mechanisms

EMP1 regulates cell proliferation, adhesion, and apoptosis through interactions with signaling pathways like Rac1 and Src kinases . Its dual role in cancer—acting as both a promoter and suppressor of metastasis—has been documented:

  • Pro-Metastatic: Upregulation in prostate cancer enhances migration and lymph node/lung metastasis via Rac1 activation .

  • Anti-Metastatic: In breast cancer, EMP1 suppresses VEGF-C expression, reducing tumor aggressiveness .

Comparative studies highlight structural conservation between Pongo abelii EMP1 and homologs in humans (Homo sapiens), mice (Mus musculus), and rabbits (Oryctolagus cuniculus) :

SpeciesSequence IdentityKey Functional Motifs
Pongo abelii (Orangutan)100%LVLLAGIFVVHIATVI (N-terminal hydrophobic)
Homo sapiens (Human)~95%Similar transmembrane topology
Oryctolagus cuniculus~92%Conserved C-terminal phosphorylation sites

Research Applications

Recombinant Pongo abelii EMP1 is utilized in:

  • Cancer Mechanistic Studies: Investigating EMP1’s role in stromal-epithelial interactions and metastasis using co-culture systems .

  • Structural Biology: Resolving lipid raft interactions and transmembrane domain organization .

  • Evolutionary Genomics: Comparative analyses of primate genomes reveal Pongo abelii’s slower structural evolution, including reduced Alu retrotransposition rates compared to humans .

Future Directions

Current research gaps include:

  • Mechanistic Insights: How EMP1’s interaction with integrins and lipid rafts modulates metastasis .

  • Therapeutic Potential: Targeting EMP1 in prednisolone-resistant leukemia or lobular breast cancer .

  • Conservation Biology: Leveraging Pongo abelii genomic stability to study hominid evolution .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Please reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
EMP1; Epithelial membrane protein 1; EMP-1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
EMP1
Target Protein Sequence
MLVLLAGIFVVHIATVIMLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDA LKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHY ANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK
Uniprot No.

Target Background

Database Links

UniGene: Pab.13920

Protein Families
PMP-22/EMP/MP20 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Epithelial Membrane Protein 1 (EMP1) and what are its basic structural characteristics in Pongo abelii?

Epithelial Membrane Protein 1 (EMP1) is a member of the peripheral myelin protein (PMP22) family that is primarily expressed in squamous epithelium. In Pongo abelii (Sumatran orangutan), EMP1 is a membrane protein with the UniProt accession number Q5RCY3. The protein has a complete amino acid sequence of: mLVLLAGIFVVHIATVImLFVSTIANVWLVSNTVDASVGLWKNCTNISCSDSLSYASEDALKTVQAFMILSIIFCVIALLVFVFQLFTMEKGNRFFLSGATTLVCWLCILVGVSIYTSHYANRDGTQYHHGYSYILGWICFCFSFIIGVLYLVLRKK . The expression region spans amino acids 1-157, making it a full-length protein. Its transmembrane structure allows it to function as a key component in cellular communication and membrane organization.

How does EMP1 from Pongo abelii compare structurally and functionally to human EMP1?

While both Pongo abelii and human EMP1 belong to the same protein family, their molecular structures contain subtle differences reflecting evolutionary divergence. Human EMP1 is officially named "EMP1 epithelial membrane protein 1" with several synonyms including tumor-associated membrane protein (TMP), CL-20, and EMP-1 . The protein binding function is conserved across species, with both human and Pongo abelii EMP1 participating in protein-protein interactions essential for cellular processes. Both variants play roles in cellular proliferation, migration, and cell death regulation, though species-specific variations in these functions may exist. The high degree of conservation suggests its fundamental importance in epithelial tissue function across primate species, making Pongo abelii EMP1 a valuable comparative model for human-focused research.

What are the known molecular interactions and binding partners of EMP1?

EMP1 engages in several protein-protein interactions that contribute to its cellular functions. According to interaction studies, EMP1 directly interacts with proteins including SYNE4, CEP70, and SMIM3 . Its protein binding capability is shared with other proteins such as NDUFA4, USP54, KRTAP19-7, C6orf226, NRP1B, ARHGDIG, ZFAND6, SIRT7, DVL1, and CAPN3 . These interactions suggest EMP1's involvement in multiple cellular pathways and processes. The protein's localization in the membrane facilitates its role as a signaling molecule and regulator of cell-cell communication. Understanding these molecular interactions is crucial for elucidating EMP1's role in normal cellular function and its potential contributions to pathological conditions.

What are the most effective expression systems for producing recombinant Pongo abelii EMP1?

The production of high-quality recombinant Pongo abelii EMP1 can be achieved through several expression systems, each with specific advantages. E. coli represents the most commonly used platform due to its rapid growth rate, high protein yields, and cost-effectiveness . For applications requiring post-translational modifications, yeast expression systems have proven effective, as demonstrated in the production of other Pongo abelii recombinant proteins .

When designing an expression protocol, researchers should consider:

  • Vector selection: Vectors containing strong promoters (T7, tac) for high-level expression

  • Fusion tags: N-terminal 6xHis or 10xHis tags for simplified purification

  • Codon optimization: Adjusting codons to match the expression host's preference

  • Growth conditions: Temperature, inducer concentration, and induction timing optimization

For membrane proteins like EMP1, maintaining proper folding can be challenging. Lower induction temperatures (16-25°C) and specialized E. coli strains designed for membrane protein expression may significantly improve functional protein yields.

What purification strategies yield the highest purity and functional activity for recombinant EMP1?

Purification of recombinant Pongo abelii EMP1 requires careful consideration of its membrane protein characteristics. An effective purification protocol typically involves:

  • Cell lysis under conditions that maintain protein structure, using gentle detergents to solubilize membrane proteins

  • Immobilized metal affinity chromatography (IMAC) utilizing the His-tag for initial capture

  • Size exclusion chromatography for further purification and buffer exchange

  • Quality assessment through SDS-PAGE analysis to achieve >85% purity

The purified protein should be stored in a Tris-based buffer containing 50% glycerol to optimize stability . For extended storage, maintaining the protein at -20°C or -80°C is recommended, while avoiding repeated freeze-thaw cycles that may compromise structural integrity and functional activity. Working aliquots can be stored at 4°C for up to one week . Functional activity assessments through binding capacity in ELISA assays provide critical validation of proper folding and biological activity.

How can researchers verify the structural integrity and biological activity of purified recombinant EMP1?

Verification of recombinant Pongo abelii EMP1's structural integrity and functional activity requires multiple complementary approaches:

  • SDS-PAGE analysis for molecular weight confirmation and purity assessment (>85% purity standard)

  • Western blotting using anti-EMP1 or anti-tag antibodies to verify protein identity

  • Functional ELISA assays to confirm binding capacity and biological activity

  • Mass spectrometry for sequence verification and post-translational modification analysis

  • Circular dichroism spectroscopy to evaluate secondary structure elements

For membrane proteins like EMP1, assessing proper folding is particularly critical. Researchers should monitor protein behavior during concentration and storage, as aggregation may indicate structural issues. Additionally, comparing the activity of the recombinant protein to native EMP1 (where possible) provides valuable benchmarking. For studies investigating EMP1's role in cellular pathways, cell-based assays examining pathway activation/inhibition after exposure to the recombinant protein offer functional validation.

What are the most reliable antibodies and detection methods for studying Pongo abelii EMP1 in experimental settings?

When selecting antibodies for Pongo abelii EMP1 research, consider both monoclonal and polyclonal options targeting different epitopes. For immunodetection experiments, researchers should:

  • Validate antibody specificity using positive controls (recombinant EMP1) and negative controls

  • Optimize antibody dilutions for specific applications (Western blotting, immunohistochemistry, flow cytometry)

  • Consider cross-reactivity with human EMP1 for comparative studies

  • Employ tag-specific antibodies when using tagged recombinant variants

Beyond antibody-based detection, mRNA expression analysis through qRT-PCR provides valuable complementary data. Primers should be designed to specifically amplify the Pongo abelii EMP1 sequence, with careful attention to avoiding regions with high homology to related proteins. For absolute quantification, standard curves generated using purified recombinant DNA templates are recommended.

For subcellular localization studies, fluorescently tagged EMP1 constructs or immunofluorescence with validated antibodies can be used in conjunction with organelle-specific markers to determine precise membrane localization patterns.

How can researchers effectively design experiments to study EMP1's role in ferroptosis pathways?

Based on research showing EMP1's involvement in reinforcing RSL3-induced ferroptosis in human cancer cells , designing experiments to investigate this role in Pongo abelii EMP1 requires careful methodological consideration:

  • Cell model selection: Choose cell lines that express low levels of endogenous EMP1 for overexpression studies, or high levels for knockdown approaches

  • Expression modulation: Create stable cell lines with inducible EMP1 expression to control timing and level of expression

  • Ferroptosis induction: Use RSL3 at varying concentrations (0.1-10 μM) to induce ferroptosis

  • Cell death assessment: Measure cell viability using multiple methods (MTT/MTS assays, flow cytometry with Annexin V/PI)

  • Mechanism investigation: Monitor lipid peroxidation (BODIPY-C11), glutathione levels, and iron metabolism

To establish causality, researchers should investigate the specific mechanistic pathway linking EMP1 to ferroptosis. Based on existing research, focusing on the Hippo-TAZ pathway and expression of Rac1 and NOX1 represents a logical experimental direction . Western blotting for these pathway components before and after EMP1 expression modulation can reveal the molecular mechanisms connecting EMP1 to ferroptotic cell death sensitivity.

What cellular and biochemical assays best elucidate EMP1's functional role in epithelial tissues?

To comprehensively investigate EMP1's function in epithelial tissues, researchers should employ multiple complementary assays:

  • Cell proliferation assays: MTT/MTS or BrdU incorporation to measure growth effects

  • Migration and invasion assays: Wound healing and Boyden chamber experiments

  • Cell-cell adhesion assessment: Aggregation assays and E-cadherin localization

  • Tight junction integrity tests: Transepithelial electrical resistance (TEER) measurements

  • Membrane protein localization: Immunofluorescence to determine colocalization with known membrane markers

For biochemical characterization, researchers should conduct protein-protein interaction studies through co-immunoprecipitation followed by mass spectrometry to identify novel binding partners in epithelial contexts. Pull-down assays using recombinant Pongo abelii EMP1 can validate direct interactions. Functional consequences of these interactions can be assessed through pathway activation studies, monitoring signaling cascades that may be influenced by EMP1's membrane localization and protein binding capabilities.

How does EMP1 expression correlate with cancer progression and what are the methodological considerations for studying this relationship?

EMP1 exhibits context-dependent expression patterns across different cancer types, with significant implications for research methodology. Studies have demonstrated increased EMP1 expression in glioblastoma multiforme, uveal melanoma, non-small-cell lung cancer, and acute lymphoblastic leukemia, while showing decreased expression in nasopharyngeal cancer, gastrointestinal cancers, colorectal cancer, and ovarian cancer .

When designing studies to investigate these relationships, researchers should:

  • Use multiple quantification methods: qRT-PCR for mRNA levels, Western blotting and immunohistochemistry for protein expression

  • Include paired normal-tumor samples from the same patient when possible

  • Analyze large cohorts with comprehensive clinical data to establish correlations with prognostic factors

  • Perform subgroup analysis based on tumor grade, stage, and molecular subtypes

Mechanistic studies should investigate whether EMP1 acts as a driver or passenger in carcinogenesis through carefully controlled expression modulation experiments. For Pongo abelii EMP1 research in comparative oncology, aligning methodologies with human studies facilitates translational relevance and cross-species insights into evolutionary conservation of EMP1's role in cancer biology.

What experimental approaches can elucidate EMP1's role in drug resistance mechanisms, particularly related to gefitinib?

Research has revealed that EMP1 overexpression can promote gefitinib resistance by targeting the MAPK pathway . To investigate this phenomenon, researchers should implement multifaceted experimental designs:

  • Generate paired sensitive and resistant cell line models through either:

    • Long-term exposure to increasing gefitinib concentrations

    • Genetic manipulation of EMP1 expression levels

  • Perform comprehensive pathway analysis focusing on:

    • MAPK pathway activation status (phosphorylation of ERK1/2, MEK)

    • Alternative receptor tyrosine kinase signaling (EGFR, HER2, MET)

    • Cell survival pathway activation (PI3K/AKT)

  • Conduct drug sensitivity testing with:

    • Dose-response curves to calculate precise IC50 values

    • Combination treatments with MAPK pathway inhibitors to test for synergy

  • Validate findings through:

    • Rescue experiments with EMP1 knockdown in resistant cells

    • In vivo xenograft models comparing drug response

A particularly informative approach is to compare transcriptional profiles between EMP1-high and EMP1-low cells before and after gefitinib treatment, which can reveal broader pathway alterations. Researchers should also investigate whether the mechanisms identified in human studies translate to Pongo abelii EMP1, potentially revealing evolutionarily conserved resistance mechanisms.

How can researchers effectively investigate the seemingly contradictory roles of EMP1 across different cancer types?

The paradoxical behavior of EMP1 across cancer types—functioning as both an oncogene and tumor suppressor—presents a complex research challenge requiring careful methodological approaches:

  • Context-specific expression analysis:

    • Comprehensive profiling across diverse tissue types

    • Correlation with tissue-specific transcription factors

    • Epigenetic regulation assessment (methylation, histone modifications)

  • Interactome mapping in different cellular contexts:

    • Tissue-specific protein-protein interaction studies

    • Pathway analysis using Gene Set Enrichment Analysis (GSEA)

    • Identification of tissue-specific binding partners

  • Functional consequence investigation:

    • Cell-type specific knockdown/overexpression experiments

    • Phenotypic assays tailored to specific cancer hallmarks

    • Multi-omics integration (transcriptomics, proteomics, metabolomics)

  • Evolutionary analysis:

    • Comparison of EMP1 function across species (including Pongo abelii)

    • Conservation analysis of interaction domains and regulatory elements

Researchers should design experiments that simultaneously measure multiple parameters to capture the full spectrum of EMP1's activities. For example, studies could examine how the same EMP1 manipulation affects different downstream pathways in distinct cellular contexts, potentially explaining why it promotes proliferation in some cancers while inhibiting it in others.

What are the cutting-edge techniques for studying EMP1's membrane dynamics and protein-protein interactions?

Advanced research into EMP1's membrane behavior and interaction network can leverage several emerging technologies:

  • Cryo-electron microscopy (cryo-EM) for structural determination:

    • Similar to approaches used for beta-glucocerebrosidase/LIMP-2 complexes

    • Potentially utilizing nanobodies as crystallization chaperones

    • Single-particle analysis for membrane protein complexes

  • Proximity labeling approaches:

    • BioID or TurboID fusion constructs to identify proximal proteins in living cells

    • APEX2-based spatial proteomics to map the EMP1 neighborhood with nanometer resolution

    • Split-BioID for detecting specific protein-protein interactions

  • Advanced imaging techniques:

    • Super-resolution microscopy (PALM, STORM) to visualize nanoscale distribution

    • Single-molecule tracking to measure diffusion dynamics in membranes

    • FRET-based biosensors to detect conformational changes and interactions

  • Membrane interactome mapping:

    • Lipidomics to identify preferential lipid interactions

    • Crosslinking mass spectrometry to capture transient interactions

    • Native mass spectrometry of membrane protein complexes

These approaches provide unprecedented insight into how EMP1 functions within membrane microdomains and how its interaction network responds to cellular perturbations. Integrating structural data with dynamic cellular measurements will advance understanding of how this protein exerts its diverse biological effects.

How can computational approaches enhance understanding of EMP1 structure-function relationships?

Computational methods offer powerful complementary approaches to experimental studies of EMP1:

  • Advanced structural prediction:

    • AlphaFold2 or RoseTTAFold for generating high-confidence structural models

    • Molecular dynamics simulations to study membrane embedding and dynamics

    • Protein-protein docking to predict interaction interfaces

  • Network biology approaches:

    • Integration of protein-protein interaction data with transcriptomics

    • Pathway enrichment analysis using ranked correlation files

    • Identification of key network nodes that mediate EMP1's diverse functions

  • Evolutionary analysis:

    • Assessment of selection pressure on different protein domains

    • Identification of conserved interaction motifs across species

    • Reconstruction of evolutionary history of the PMP22 family

  • Machine learning applications:

    • Prediction of post-translational modifications affecting function

    • Classification of cancer samples based on EMP1-associated signatures

    • Drug response prediction based on EMP1 expression patterns

These computational approaches can generate testable hypotheses about structure-function relationships that guide subsequent experimental validation. Particular attention should be paid to the transmembrane domains, which likely mediate both membrane insertion and protein-protein interactions critical for EMP1's diverse functions.

What methodological approaches are most promising for translating EMP1 research into therapeutic applications?

Translating EMP1 research toward potential therapeutic applications requires robust methodological frameworks:

  • Target validation strategies:

    • CRISPR-Cas9 screens to identify synthetic lethal interactions

    • Patient-derived xenograft models with EMP1 modulation

    • Correlation of EMP1 expression with clinical outcomes across cancer types

  • Therapeutic development approaches:

    • Small molecule screening targeting EMP1-dependent pathways

    • Monoclonal antibody development against extracellular domains

    • Proteolysis-targeting chimeras (PROTACs) for selective degradation

  • Precision medicine applications:

    • Development of EMP1 expression as a biomarker for stratified treatment

    • Correlation of EMP1 status with response to ferroptosis inducers

    • Integration with other markers to create composite predictive signatures

  • Drug resistance mechanisms:

    • Detailed mapping of how EMP1 modulates MAPK pathway in gefitinib resistance

    • Identification of combination approaches to overcome resistance

    • Temporal studies of EMP1 expression changes during treatment

The seemingly contradictory roles of EMP1 across cancer types necessitate context-specific therapeutic approaches. Researchers should employ maximally selected rank statistics for defining optimal cutoff points when classifying tumors by EMP1 expression , ensuring reproducible stratification for clinical application development. Additionally, leveraging non-conventional cell sorting mechanisms that rely on EMP1's membrane properties could yield novel drug delivery strategies for targeting specific cellular compartments.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.