Recombinant Pongo abelii Fatty acid desaturase 2 (FADS2)

Shipped with Ice Packs
In Stock

Description

Functional Roles and Catalytic Activity

FADS2 is a multifunctional enzyme with diverse substrate specificity:

  • Primary Activity: Acts as a Δ6-desaturase, converting linoleic acid (18:2n-6) and α-linolenic acid (18:3n-3) into γ-linolenic acid (GLA) and stearidonic acid (SDA), respectively .

  • Alternative Activity: Demonstrates Δ8-desaturase activity, metabolizing 20:2n-6 and 20:3n-3 into 20:3n-6 and 20:4n-3, bypassing traditional LC-PUFA synthesis pathways .

  • Competitive Substrate Preferences:

    Substrate PairPreference Ratio
    18:2n-6 vs 20:2n-6Δ6 > Δ8 by 7-fold
    18:3n-3 vs 20:3n-3Δ6 > Δ8 by 23-fold

Pathway Involvement and Interactions

FADS2 participates in critical metabolic pathways:

PathwayKey Associated Proteins
Biosynthesis of unsaturated fatty acidsSCD, ELOVL2, FADS1, ACOX3
PPAR signalingPPARA, CPT1C, ACSL3A
Fatty acid metabolismFASN, HADH, ACSL1

Interacting Proteins:

  • Direct interactions with Hsd3b7 (3β-hydroxysteroid dehydrogenase) suggest roles in steroid metabolism .

Evolutionary and Biomedical Significance

  • Evolutionary Plasticity: FADS2 exhibits remarkable adaptability, with gene duplication events enabling functional diversification in vertebrates .

  • Health Implications: Polymorphisms in FADS2 correlate with altered LC-PUFA levels, influencing inflammatory responses and disease risk .

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format currently in stock. However, if you have specific requirements for the format, please indicate them in your order. We will prepare the product according to your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
The shelf life of our products is influenced by several factors including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, the shelf life of liquid formulations is 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
We will determine the tag type during production. If you have a specific tag type in mind, please inform us and we will prioritize developing it accordingly.
Synonyms
FADS2; Acyl-CoA 6-desaturase; Delta(6 fatty acid desaturase; D6D; Delta(6 desaturase; Delta-6 desaturase; Fatty acid desaturase 2
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-444
Protein Length
full length protein
Species
Pongo abelii (Sumatran orangutan) (Pongo pygmaeus abelii)
Target Names
Target Protein Sequence
MGKGGNQGEGAAEREVSVPTFSWEEIQKHNLRTDRWLVIDRKVYNITKWSIQHPGGQRVI GHYAGEDATDAFRAFHPDLEFVGKFLKPLLIGELAPEEPSQDHGKNSKITEDFRALRKTA EDMNLFKTNHVFFLLLLAHIIALESIAWFTVFYFGNGWISTLITAFVLATSQAQAGWLQH DYGHLSVYRKPKWNHLVHKFVIGHLKGASANWWNHRHFQHHAKPNIFHKDPDVNMLHVFV LGEWQPIEYGKKKLKYLPYNHQHEYFFLIGPPLLIPMYFQYQIIMTMIVHKNWVDLAWAI SYYIRFFITYIPFYGILGALLFLNFIRFLESHWFVWVTQMNHIVMEIDQEAYRDWFSSQL TATCNVEQSFFNDWFSGHLNFQIEHHLFPTMPRHNLHKIAPLVKSLCAKHGIEYQEKPLL RALLDIIRSLKKSGKLWLDAYLHK
Uniprot No.

Target Background

Function
Fatty acid desaturase 2 (FADS2) plays a critical role in the biosynthesis of highly unsaturated fatty acids (HUFA) from essential polyunsaturated fatty acids (PUFA) such as linoleic acid (LA) (18:2n-6) and alpha-linolenic acid (ALA) (18:3n-3). Acting as a fatty acyl-coenzyme A (CoA) desaturase, FADS2 introduces a cis double bond at carbon 6 of the fatty acyl chain. This enzyme catalyzes the initial and rate-limiting step in this pathway, converting LA (18:2n-6) and ALA (18:3n-3) into gamma-linoleate (GLA) (18:3n-6) and stearidonate (18:4n-3), respectively. In the biosynthetic pathway of HUFA n-3 series, FADS2 desaturates tetracosapentaenoate (24:5n-3) to tetracosahexaenoate (24:6n-3), which is further converted to docosahexaenoate (DHA)(22:6n-3), an essential lipid for proper nervous system function. FADS2 can also desaturate (11E)-octadecenoate (trans-vaccenoate) at carbon 6, generating (6Z,11E)-octadecadienoate. Beyond its Delta-6 activity, this enzyme exhibits Delta-8 activity with slight biases toward n-3 fatty acyl-CoA substrates.
Database Links
Protein Families
Fatty acid desaturase type 1 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is the primary function of FADS2 in fatty acid metabolism?

FADS2 (Fatty Acid Desaturase 2) catalyzes the first and rate-limiting step in the biosynthesis of long-chain polyunsaturated fatty acids (LC-PUFAs). This crucial enzyme introduces double bonds at specific positions in fatty acid carbon chains through dehydrogenation reactions. In mammals, FADS2 primarily functions as a Delta6-desaturase, converting essential dietary fatty acids like linoleic acid (LA, 18:2n-6) and alpha-linolenic acid (ALA, 18:3n-3) to gamma-linoleic acid and stearidonic acid, respectively. These products serve as precursors for biologically significant LC-PUFAs such as arachidonic acid and eicosapentaenoic acid, which play vital roles in membrane structure and signaling pathways.

How does the structural organization of FADS2 relate to its catalytic function?

FADS2 is a hydrophobic membrane-bound protein with two primary structural domains: a cytochrome b5-like domain at the N-terminus and a main desaturation domain containing three histidine-rich regions at the C-terminus. The N-terminal cytochrome b5-like domain, featuring a highly conserved heme-binding HPGG motif, enables direct electron transfer from NADH cytochrome b5 reductase to the catalytic site without requiring an independent cytochrome b5. The C-terminal domain contains three histidine-boxes with highly conserved histidine residues that coordinate two iron atoms at the active site, positioning them in close proximity to the fatty acid substrate. These structural elements work cooperatively to facilitate the desaturation reaction. Despite its importance, a complete three-dimensional crystal structure of FADS2 remains unavailable, making structural analyses particularly challenging for researchers.

What substrate specificity does Pongo abelii FADS2 exhibit compared to other species?

While the search results don't specifically detail Pongo abelii FADS2 substrate specificity, mammalian FADS2 enzymes generally demonstrate activity toward multiple substrates with varying preferences. Competition experiments with other mammalian FADS2 have shown that Delta8-desaturation favors activity toward 20:3n-3 over 20:2n-6 by approximately 3-fold. Similarly, Delta6-desaturase activity is favored over Delta8-desaturase activity by 7-fold and 23-fold for n-6 (18:2n-6 vs 20:2n-6) and n-3 (18:3n-3 vs 20:3n-3) substrates, respectively. For Pongo abelii FADS2 characterization, researchers should employ competitive substrate assays with radiolabeled fatty acids to determine relative conversion rates and kinetic parameters (Km and Vmax) for each potential substrate, enabling precise comparison with FADS2 from humans and other primates.

What expression systems are most effective for recombinant Pongo abelii FADS2 production?

For recombinant expression of Pongo abelii FADS2, researchers have multiple expression system options, each with distinct advantages. Saccharomyces cerevisiae has been successfully used for FADS2 expression from other species, as demonstrated in studies where baboon FADS2 was expressed in yeast, confirming its Delta8-desaturase activity. The yeast system offers advantages for functional characterization since it lacks endogenous LC-PUFA biosynthetic machinery that might interfere with activity assessments. For structural studies requiring higher protein yields, researchers might consider mammalian expression systems like HEK293 or CHO cells, which provide proper post-translational modifications and membrane insertion. Bacterial systems like E. coli, while offering high protein yields, may face challenges with proper folding of this complex membrane protein. For optimal results, researchers should clone the full-length Pongo abelii FADS2 cDNA into vectors containing appropriate affinity tags, and verify expression through Western blotting before proceeding to activity assays.

How can researchers effectively measure FADS2 enzymatic activity in vitro?

To measure recombinant Pongo abelii FADS2 enzymatic activity in vitro, researchers should implement a comprehensive approach combining multiple analytical techniques. The gold standard involves supplying the recombinant protein or FADS2-expressing cells with specific fatty acid substrates (such as 18:2n-6, 18:3n-3, 20:2n-6, or 20:3n-3), followed by extraction of total cellular lipids using chloroform/methanol mixtures. Fatty acid methyl esters (FAMEs) can then be prepared through transmethylation with methanolic HCl and analyzed via gas chromatography (GC) or GC-mass spectrometry to identify and quantify the desaturated products. For more precise kinetic measurements, researchers should use radiolabeled substrates (e.g., [1-14C]18:3n-3) and measure conversion rates at various substrate concentrations to determine parameters like Km and Vmax. Additionally, competition experiments using mixed substrates at defined ratios help determine substrate preferences, while site-directed mutagenesis of conserved histidine residues can confirm the involvement of specific amino acids in catalytic activity.

What purification strategies overcome the challenges of working with membrane-bound FADS2?

Purifying recombinant Pongo abelii FADS2 presents significant challenges due to its hydrophobic, membrane-bound nature. An effective purification strategy begins with optimizing the expression construct to include an N- or C-terminal affinity tag (hexahistidine or FLAG tag) that doesn't interfere with the cytochrome b5 domain or the three histidine-rich catalytic regions. Following expression, membrane fractions should be isolated through differential centrifugation and solubilized using gentle detergents such as n-dodecyl-β-D-maltoside (DDM), digitonin, or CHAPS, which maintain protein stability and function. Affinity chromatography (using Ni-NTA for His-tagged constructs) followed by size-exclusion chromatography provides effective purification. Throughout the process, researchers should monitor protein stability using thermal shift assays and preserve enzyme activity by maintaining a reducing environment with DTT or β-mercaptoethanol. For functional studies, reconstitution into proteoliposomes or nanodiscs may be necessary to provide a native-like membrane environment. The addition of stabilizing agents like glycerol (10-15%) in all buffers helps maintain protein integrity during purification steps.

What is the molecular basis for the dual Delta6/Delta8 desaturase activity observed in FADS2?

The remarkable dual catalytic capability of FADS2 as both a Delta6 and Delta8 desaturase stems from specific structural features of its active site. The enzyme contains three histidine-rich regions that coordinate iron atoms essential for catalysis, along with a flexible substrate binding channel that can accommodate fatty acids of various chain lengths and existing desaturation patterns. Molecular docking and mutagenesis studies suggest that certain key residues within the substrate binding channel determine regioselectivity by positioning carbon atoms precisely for desaturation. The flexibility in substrate accommodation likely results from subtle variations in how different fatty acids interact with these residues, allowing FADS2 to introduce double bonds at either the Delta6 or Delta8 position depending on substrate presentation. When comparing activities, Delta6-desaturase functionality is favored over Delta8-desaturase activity by approximately 7-fold for n-6 fatty acids (18:2n-6 vs. 20:2n-6) and 23-fold for n-3 fatty acids (18:3n-3 vs. 20:3n-3), indicating differential binding affinities and catalytic efficiencies for these positions. This dual functionality provides metabolic flexibility in LC-PUFA biosynthesis, offering alternative routes when standard pathways are compromised.

How do the three histidine-rich regions contribute to the catalytic mechanism of FADS2?

The three histidine-rich regions in FADS2 play critical roles in its desaturase activity through a coordinated mechanism essential for catalysis. These conserved "His-boxes" contain histidine residues that directly coordinate two iron atoms at the active site, positioning them to interact with molecular oxygen and facilitate electron transfer during the desaturation reaction. The precise spatial arrangement of these histidines creates the catalytic core that removes hydrogen atoms from specific carbon positions in the fatty acid substrate. Structural predictions suggest these histidine residues form a "contact zone" with the fatty acid substrate, ensuring proper alignment for regioselective desaturation. Mutational studies in related desaturases have demonstrated that altering even a single histidine residue in these conserved regions can dramatically reduce or eliminate catalytic activity, confirming their essential role. These histidine-rich regions represent the most highly conserved elements across fatty acid desaturases from diverse species, highlighting their fundamental importance in the desaturation mechanism. For Pongo abelii FADS2, these regions likely follow the canonical arrangement found in mammalian desaturases, though species-specific amino acid variations surrounding these histidines may influence substrate preference or catalytic efficiency.

How does the cytochrome b5-like domain influence electron transfer in the FADS2 desaturation reaction?

The cytochrome b5-like domain at the N-terminus of FADS2 plays a crucial role in the electron transfer mechanism required for desaturation activity. This domain contains a highly conserved HPGG motif that facilitates heme binding, creating an electron relay system essential for catalysis. During desaturation, electrons flow from NADH to NADH-cytochrome b5 reductase, then to the heme group within the cytochrome b5-like domain of FADS2, and finally to the di-iron center at the catalytic site where substrate desaturation occurs. Research has demonstrated that both this integrated cytochrome b5-like domain and independent microsomal cytochrome b5 are necessary for optimal Delta6 desaturation activity, with neither able to fully compensate for the absence of the other. This suggests a complex electron transfer mechanism involving multiple components. Mutation studies targeting the HPGG motif result in dramatic activity reduction, confirming the domain's essential role. The fusion of this cytochrome b5-like domain to the main desaturase domain represents an evolutionary adaptation that enhances catalytic efficiency by bringing electron transfer and desaturation functions into a single protein complex, though the precise structural arrangement that facilitates this interaction remains under investigation due to the absence of crystallographic data for membrane-bound desaturases.

How does Pongo abelii FADS2 compare functionally to FADS2 enzymes from other primates?

While the search results don't provide specific comparative data for Pongo abelii FADS2, evolutionary analyses of primate FADS2 enzymes reveal important functional conservation with species-specific adaptations. Generally, primate FADS2 enzymes share high sequence homology (typically >90% amino acid identity), particularly in catalytic domains and substrate binding regions. Functional studies of recombinant FADS2 from various primates have demonstrated similar primary Delta6-desaturase activities with subtle variations in substrate preferences and catalytic efficiencies that reflect dietary adaptations. For example, baboon FADS2 has been experimentally confirmed to possess both Delta6 and Delta8 desaturase activities, with specific preferences for certain substrates as determined through competition experiments. To properly characterize Pongo abelii FADS2 in comparison to other primates, researchers should conduct side-by-side enzymatic assays using identical substrates and conditions, measuring parameters such as substrate preference ratios, conversion rates, and kinetic constants. These comparative analyses would provide insights into how evolutionary pressures related to dietary adaptation have shaped FADS2 function in orangutans compared to other great apes and humans.

What can the evolutionary divergence of FADS genes in mammals versus fish tell us about FADS2 functional plasticity?

The evolutionary history of FADS genes provides profound insights into FADS2 functional plasticity. A fundamental difference exists between mammals and fish: mammals possess distinct FADS1 and FADS2 genes encoding enzymes with Δ5 and Δ6 activities respectively, while most fish have lost the FADS1 gene during evolution. Consequently, fish FADS2 enzymes have evolved remarkable functional plasticity, with various species' FADS2 enzymes acquiring diverse desaturase activities (Δ6, Δ5, Δ4, and Δ8) to compensate for the loss of FADS1. This represents a compelling example of convergent evolution through subfunctionalization following gene duplication or neofunctionalization. For example, zebrafish FADS2 has acquired Δ5 activity in addition to its native Δ6 function, while the marine herbivorous fish Siganus canaliculatus possesses a FADS2 with Δ4 activity—the first such enzyme discovered in vertebrates. This plasticity suggests that the FADS2 active site has inherent structural flexibility that allows for adaptation to different substrates under evolutionary pressure, particularly in response to dietary availability of LC-PUFAs. This evolutionary perspective provides valuable insights for understanding how environmental and dietary factors might influence FADS2 activity in Pongo abelii and other primates.

What role have copy number variations played in FADS2 evolution across species?

Copy number variations (CNVs) have played a significant role in FADS2 evolution across species, contributing to functional diversification and adaptation to different dietary environments. The search results briefly mention FADS2 gene duplication events, particularly in fish species. In Atlantic salmon, duplicated Δ6 and Δ5 FADS2 paralogs share greater than 95% nucleic acid identity, suggesting a recent duplication event likely resulting from the salmonid whole genome duplication. These duplications create opportunities for neofunctionalization, where one copy maintains the original function while the other evolves new desaturase activities. In species that have lost the ancestral FADS1 gene (which typically provides Δ5 desaturase activity), FADS2 duplication has been a crucial mechanism to recover lost enzymatic functions, as in some teleost lineages. Additionally, reference mentions copy number variation of fatty acid desaturases, suggesting this mechanism continues to be relevant in contemporary evolution. For Pongo abelii specifically, researchers should investigate whether its genome contains single or multiple FADS2 copies and how this genetic architecture influences its LC-PUFA biosynthetic capacity compared to other primates. Comparative genomic analyses combined with functional enzymatic studies would provide insights into how CNVs have shaped FADS2 adaptation in response to evolutionary dietary shifts.

What are the optimal heterologous expression systems for studying structure-function relationships of Pongo abelii FADS2?

For studying structure-function relationships of Pongo abelii FADS2, researchers should consider multiple heterologous expression systems, each offering distinct advantages depending on the specific research questions. For initial functional characterization, Saccharomyces cerevisiae represents an excellent system due to its lack of endogenous LC-PUFA biosynthetic machinery, preventing background interference in activity assays. This approach has proven successful with baboon FADS2, allowing clear demonstration of both Delta6 and Delta8 desaturase activities. The yeast expression protocol should include: 1) cloning the full FADS2 coding sequence into a yeast expression vector with a strong inducible promoter (e.g., GAL1), 2) transformation into a protease-deficient yeast strain, 3) induction in media supplemented with potential fatty acid substrates, and 4) analysis of fatty acid profiles using GC-MS. For structural studies requiring higher protein yields and proper post-translational modifications, insect cell systems (Sf9 or High Five cells with baculovirus vectors) offer a eukaryotic environment while providing larger biomass. For mutational analyses to identify critical residues in substrate binding or catalysis, both yeast and mammalian cell systems (HEK293, CHO) can be employed, with site-directed mutagenesis targeting conserved histidine residues or predicted substrate-binding regions based on homology modeling.

What methodological approaches can elucidate the membrane topology of FADS2?

Elucidating the membrane topology of Pongo abelii FADS2 requires a multi-faceted approach combining computational prediction and experimental validation. Researchers should begin with in silico analyses using specialized algorithms like Phobius, TMHMM, or TOPCONS to predict transmembrane domains and their orientation. Based on findings from related desaturases, FADS2 likely contains four transmembrane regions with both N- and C-termini facing the cytosol. To experimentally validate these predictions, researchers can employ several complementary techniques: 1) Selective permeabilization combined with immunodetection using domain-specific antibodies can determine which regions are accessible from cytosolic or luminal sides; 2) Glycosylation mapping using engineered N-glycosylation sites at various positions can identify luminal domains; 3) Cysteine scanning mutagenesis coupled with chemical labeling can determine the accessibility of specific residues; 4) Fluorescence protease protection assays using GFP fusions can distinguish cytosolic from luminal domains. The Persian-language source mentions using computational servers including Swissmodel, Predict, and Phobius to analyze FADS2 topology, identifying the cytochrome b5 domain containing the HPGG motif, three histidine box motifs, and transmembrane regions. This comprehensive approach provides a detailed topological map essential for understanding how FADS2 functions within the membrane environment.

How can researchers effectively model the substrate binding pocket of FADS2 in the absence of crystal structure data?

In the absence of crystal structure data for FADS2, researchers can employ an integrated computational and experimental approach to model its substrate binding pocket. Begin with homology modeling using evolutionarily related proteins with known structures as templates, such as the mammalian stearoyl-CoA desaturase (Δ9 desaturase) whose crystal structures have been determined in humans and rats. While sequence identity may be moderate, focusing on the conservation of catalytic residues, particularly the three histidine-rich regions, provides structural anchors for the model. Employ multiple modeling platforms (SWISS-MODEL, I-TASSER, Rosetta) and validate through consensus approaches. Refine the homology model through molecular dynamics simulations in a membrane environment to optimize protein-lipid interactions and binding pocket conformation. Once a preliminary model is established, perform in silico docking of known substrates (LA, ALA, 20:2n-6, 20:3n-3) to identify potential substrate-binding residues. To experimentally validate these predictions, conduct alanine-scanning mutagenesis of predicted binding pocket residues followed by activity assays to determine their impact on substrate specificity and catalytic efficiency. Additionally, use chemical cross-linking coupled with mass spectrometry to identify residues in proximity to bound substrate analogs. This iterative approach combining computational prediction with experimental validation allows researchers to progressively refine the substrate binding pocket model despite the absence of crystallographic data.

What are the major technical challenges in crystallizing membrane-bound FADS2, and what alternative approaches might yield structural insights?

Crystallizing membrane-bound FADS2 presents several major technical challenges that have prevented determination of its three-dimensional structure. The hydrophobic nature of FADS2, with multiple transmembrane domains, creates difficulties in extraction, purification, and maintaining protein stability in solution. Additionally, the conformational flexibility required for catalysis and the presence of bound lipids can result in structural heterogeneity that hinders crystal formation. To overcome these obstacles, researchers should explore alternative approaches for structural determination. Cryo-electron microscopy (cryo-EM) has emerged as a powerful technique for membrane protein structure elucidation without requiring crystallization, though achieving sufficient resolution may require innovative strategies like using antibody fragments to increase particle size. Hydrogen-deuterium exchange mass spectrometry (HDX-MS) can provide insights into protein dynamics and solvent accessibility of different regions. Solid-state NMR spectroscopy, particularly when combined with selective isotopic labeling, offers another avenue for structural analysis of membrane proteins in a near-native environment. For crystallization attempts, researchers might employ lipidic cubic phase methods, which have proven successful for other membrane proteins, or engineer FADS2 by replacing flexible regions with well-folded domains to enhance stability. The recent advances in AlphaFold2 and other AI-based structure prediction methods also offer promising computational approaches to generate structural models with increasing accuracy.

How might understanding FADS2 structure-function relationships contribute to addressing global LC-PUFA nutritional limitations?

Understanding the structure-function relationships of FADS2 has far-reaching implications for addressing global LC-PUFA nutritional limitations. As LC-PUFAs have been identified as globally limited nutrients, elucidating the molecular mechanisms of FADS2 could enable several impactful approaches. First, detailed knowledge of substrate binding determinants and catalytic mechanisms could guide protein engineering efforts to create enhanced FADS2 variants with increased catalytic efficiency or altered substrate specificity. These engineered enzymes could be introduced into transgenic organisms to improve endogenous LC-PUFA production in both aquaculture species and agricultural crops. Second, understanding the genetic variations in FADS2 that lead to more efficient LC-PUFA production could inform selective breeding programs to develop fish strains with enhanced ability to convert plant-derived C18 PUFAs to health-beneficial EPA and DHA, reducing dependence on wild fish stocks for aquaculture feed. Additionally, structure-based drug design could potentially yield small molecule activators of FADS2 to enhance its activity in humans with suboptimal LC-PUFA metabolism. Finally, comparative analysis of FADS2 across species like Pongo abelii and other primates could reveal evolutionary adaptations to different dietary LC-PUFA availability, providing insights into human nutritional requirements and personalized nutrition strategies. The search results specifically mention the importance of FADS2 in the context of growing aquaculture demand and dwindling LC-PUFA supply, highlighting its significant practical relevance.

What insights could comparative analysis of FADS2 across different orangutan species provide about dietary adaptation and evolution?

Comparative analysis of FADS2 across different orangutan species (Pongo abelii, Pongo pygmaeus, and Pongo tapanuliensis) could provide valuable insights into dietary adaptation and evolution in these critically endangered great apes. Orangutans exhibit distinct feeding ecologies: Sumatran orangutans (P. abelii) consume more insects and higher-quality fruits, while Bornean orangutans (P. pygmaeus) rely more heavily on lower-quality foods with greater seasonal variation, and the recently discovered Tapanuli orangutan (P. tapanuliensis) has unique dietary adaptations to its limited habitat. A comprehensive study would involve sequencing and functionally characterizing FADS2 from all three species to identify amino acid differences, particularly in substrate-binding regions or catalytic domains. Expression levels and tissue distribution patterns might reveal adaptations to differing dietary LC-PUFA availability. Enzyme kinetics studies could detect variations in substrate preference or catalytic efficiency that reflect evolutionary adaptation to their specific diets. Researchers should also examine genetic variation within populations, focusing on regulatory regions that might influence FADS2 expression levels. Additionally, comparison with the FADS2 of other great apes, particularly humans, could illuminate how LC-PUFA metabolism has adapted during primate evolution in response to changing dietary patterns. These insights could not only enhance our understanding of orangutan dietary adaptations but also provide perspective on human LC-PUFA metabolism evolution and inform conservation efforts by highlighting nutritional considerations for these endangered species.

Table 2: Structural Features of Mammalian FADS2 Enzymes

Structural ElementPositionConserved MotifFunction
Cytochrome b5-like domainN-terminusHPGGHeme binding for electron transfer
First histidine-rich regionCentralHDXGHIron coordination at catalytic site
Second histidine-rich regionCentralHFQHHIron coordination at catalytic site
Third histidine-rich regionC-terminusQIEHHIron coordination at catalytic site
Transmembrane regionsThroughoutHydrophobic stretchesMembrane anchoring and substrate channel formation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.